Citrus Sinensis ID: 004296


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760---
MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHPKSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGMLFSHLKDVAEKNLEMPVVDCVIGVPSYFTDLQRREYLNAASIAGLRPLRLIHDCTATALGYGIYKTDFANGGKSYIAFVDIGHSDTQVSIVSFEAGHMKVLSHAFDSSLGGRDFDDVLFGYFAAKFKEQYKINVYSNVRACIRLRAACEKLKKVLSANAEAPLNIECLMDEKDVRGFIKREEFEELASGLTEKIAIPCRKALADAGLHVDKIHSVEIVGSGSRIPAITRLLTSLFGREPRRSLNASECVARGCALQCAMLSPAFRVREYEVQDCNPYSIGISSDEGPICIGSNTNGEVFPKGQPIPCVKVLTLQRSSLFHLELFYTNPNELPPGISSKVSCFTIGPFQGSNSENAKVKVTVKLNLHGIVSVESAWLIEGHGDDPVTKHNARSKMDKMESEGVSIDSSTTVEDVQDSASVQSKSSHSSAVSVVRDKAGRRLDISISETIYGGMTKPELALAQETENLLAQQDITMEQTKDKKNALESYVYEMRNKLFSTYRSFASDQEREGISRSLQETEEWLYDDGDDETANTYASKLEDLKKLVDPIENRYKDGEARAQATRDLLQCIVEYRTAVGSLPPEEQDFIISECYKAEQWLREIAQQQDSLPKNTDPILWSGDIKRRTEDLKLKCQHLLKGETPDA
ccCEEEEcccccEEEEEEEcccEEECcccccccccccCEEcccccccccHHHHHHHcccccccccHHHHHcccccccHHHHHHHccccCEEEEcccccEEEEEEEccEEEEccHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHccccccEEccHHHHHHHHHccccccccccccEEEEEEEEccccEEEEEEEEEccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccccEEEEECcccccCEEECcccccccccccccCECccccccccCEEEEEEEccccEEEEEEccccccccccccccCEEEEcccccccccccEEEEEEEEcccccEEEEccEECccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccccc
MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHPKSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGMLFSHLKDVAEKNLEMPVVDCVIGVPSYFTDLQRREYLNAASIAGLRPLRLIHDCTATALGYGIYKTDFANGGKSYIAFVDIGHSDTQVSIVSFEAGHMKVLSHAFDSSLGGRDFDDVLFGYFAAKFKEQYKINVYSNVRACIRLRAACEKLKKVLSANAEAPLNIECLMDEKDVRGFIKREEFEELASGLTEKIAIPCRKALADAGLHVDKIHSVEIVGSGSRIPAITRLLTSLFGREPRRSLNASECVARGCALQCAMLSPAFRVREYEVQDCNPYSIGISSDEGPICIGSNTNGEVFPKGQPIPCVKVLTLQRSSLFHLELFYTNPNELPPGISSKVSCFTIGPFQGSNSENAKVKVTVKLNLHGIVSVESAWLIEGHG*********************************************************RLDISISETIYGGMTKPELALAQETENLLAQQDITMEQTKDKKNALESYVYEMRNKLFSTYRSFASDQEREGISRSLQETEEWLYDDGDDETANTYASKLEDLKKLVDPIE*********AQATRDLLQCIVEYRTAVGSLPPEEQDFIISECYKAEQWLREIAQ*********DPILWSGDIKRRTEDLKLKCQHL*KGE****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVVGFDIGNENCVIATVKHRGVDVLLNEESNRETPSIVCFGEKQRFIGAAGYASAMMHPKSTVSQVKRLIGRRYGDPVVQKDLMVLPFESCESPDGGISIKLKYLGETHTFCPVQVMGMLFSHLKDVAEKNLEMPVVDCVIGVPSYFTDLQRREYLNAASIAGLRPLRLIHDCTATALGYGIYKTDFANGGKSYIAFVDIGHSDTQVSIVSFEAGHMKVLSHAFDSSLGGRDFDDVLFGYFAAKFKEQYKINVYSNVRACIRLRAACEKLKKVLSANAEAPLNIECLMDEKDVRGFIKREEFEELASGLTEKIAIPCRKALADAGLHVDKIHSVEIVGSGSRIPAITRLLTSLFGREPRRSLNASECVARGCALQCAMLSPAFRVREYEVQDCNPYSIGISSDEGPICIGSNTNGEVFPKGQPIPCVKVLTLQRSSLFHLELFYTNPNELPPGISSKVSCFTIGPFQGSNSENAKVKVTVKLNLHGIVSVESAWLIEGHGDDPVTKHNARSKMDKMESEGVSIDSSTTVEDVQDSASVQSKSSHSSAVSVVRDKAGRRLDISISETIYGGMTKPELALxxxxxxxxxxxxxxxxxxxxxKNALESYVYEMRNKLFSTYRSFASDQEREGISRSLQETEEWLYDDGDDETANTYASKLEDLKKLVDPIENRYKDGEARAQATRDLLQCIVEYRTAVGSLPPEEQDFIISECYKAEQWLREIAQQQDSLPKNTDPILWSGDIKRRTEDLKLKCQHLLKGETPDA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat shock 70 kDa protein 16 probableQ9SAB1
Uncharacterized protein C30C11.4 probableQ05036
Heat shock 70 kDa protein 4L Possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.probableP48722

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D2F, chain A
Confidence level:very confident
Coverage over the Query: 1-498,553-684
View the alignment between query and template
View the model in PyMOL
Template: 3LOF, chain A
Confidence level:confident
Coverage over the Query: 674-720,733-758
View the alignment between query and template
View the model in PyMOL