Citrus Sinensis ID: 004332


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760
MPTGVMIPARNMPSTIGRNGNVGGLGSSSGLTLSQPTNMMEGQLHPLDMTQNTSESEIARLREEEFDSTKSGSENHEGASGDDQEQRPNKKKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKTQHERHENTQLRTENEKLRADNMRYREALSNASCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPLLSPPVPSRPLELAVGNFGAQPGIGGGEMYGAADLLRSISAPTEADKPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASVMATNIPTGEVGVITNQDGRKSMLKLAERMVISFCAGVSASTAHTWTTLSGTGADDVRVMTRKSVDDPGRPPGIVLSAATSFWLPVPPKRVFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAILPDGTSLHGANIGEAASGGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASLSCESA
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEccccccEEEEcccccccccccccccccccccccccccEEEEEcHHHHHHHHcccccHHHcccccccccEEEEEEEccccccccccEEEEHHHHcccccccccEEEEEEEEEEEEcccEEEEEEEEcccccccccccEEEcccccEEEEcccccEEEEEEEEEEEccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEccccccccccEEEEEEEccccccccHHHHHHHHcccccccHHHHcccccccEEEEEcccccccccEEEEEEEcccccccccEEEEEEEcccccccEEEEccccHHHHHHHHcccccccccccccccEEccccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEccccccEEEEcccHHcccccccccccccccEEEEEcccEEEEEcHHHHHHHHHccHHHHHHcHHHHHHHccHEEEccccccccccHEHHEHEEEccccccccHcHEEEEEEEHEcccccEEEEEEEcccccccccccEEEccccEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEcccccccccccEEEEEcHEEcccccHHHHHHHHHccccccHHHHHcccccEEEEEEHccccccccEEEEEEEcccccccccEEEEEEccccccccEEEEccccHHHHHHHHccccccccccccccEEEEccccccccccccccccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccc
mptgvmiparnmpstigrngnvgglgsssgltlsqptnmmegqlhpldmtqntsESEIARLREeefdstksgsenhegasgddqeqrpnkkkryhrHTQHQIQEMEAFfkecphpddkQRKELSRelgleplqvKFWFQNKRTQMKTQHERHENTQLRTENEKLRADNMRYREalsnascpncggptaigemsfdeHHLRLENARLREEIDRISAIAAKyvgkpvvnypllsppvpsrplelavgnfgaqpgigggemyGAADLLrsisapteadkPMIIELAVAAMEELIRMAQMgeplwmtsldgtaavlnedeyvrtfprgigpkptgfkceaSRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTaefqvpsplvptresYYVRYCKQHGEGTWAVVDVSldnlrpspavrcrrrpsgcliqempngyskVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASVmatniptgevgvitnqDGRKSMLKLAERMVISFCAgvsastahtwttlsgtgaddvrVMTRksvddpgrppgiVLSAatsfwlpvppkrvfdflrdentrsewdilsnggvvQEMAHiangrdtgnCVSLLRVnsanssqsNMLILqesctdptasfviyapVDIVAMNVVlnggdpdyvallpsgfailpdgtslhganigeaasggslLTVAFQILVDsvptaklslgsvATVNNLIACTVERIKASLSCESA
mptgvmiparnmpstigrngNVGGLGSSSGLTLSQPTNMMEGQLHPLDMTQNTSESEIARLREEEfdstksgsenhegasgddqeqrpnKKKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELgleplqvkfwFQNKRTQmktqherhentqlrteneklRADNMRYREAlsnascpnCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPLLSPPVPSRPLELAVGNFGAQPGIGGGEMYGAADLLRSISAPTEADKPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRtfprgigpkptgfkCEASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDvsldnlrpspavrcrrrpsgcliqempngySKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASvmatniptgevgvitnqDGRKSMLKLAERMVISFCAGVsastahtwttlsgtgaddvrVMTRKsvddpgrpPGIVLSaatsfwlpvppKRVFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAILPDGTSLHGANIGEAASGGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIkaslscesa
MPTGVMIPARNMPSTIGRNGNVgglgsssgltlsQPTNMMEGQLHPLDMTQNTSESEIARLREEEFDSTKSGSENHEGASGDDQEQRPNKKKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKTQHERHENTQLRTENEKLRADNMRYREALSNASCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYpllsppvpsrplelAVGNFGAQPGIGGGEMYGAADLLRSISAPTEADKPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASVMATNIPTGEVGVITNQDGRKSMLKLAERMVISFCAGVSASTAHTWTTLSGTGADDVRVMTRKSVDDPGRPPGIVLSAATSFWLPVPPKRVFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAILPDGTSLHGANIGEAASGGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASLSCESA
*********************************************************************************************************************************EPLQVKFWFQ***********************************************TAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPLLSPPVPSRPLELAVGNFGAQPGIGGGEMYGAADLLRSISAPTEADKPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASVMATNIPTGEVGVITNQDGRKSMLKLAERMVISFCAGVSASTAHTWTTLSGTGADDVRVM************GIVLSAATSFWLPVPPKRVFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNS******NMLILQESCTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAILPDGTSLHGANIGEAASGGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKA*******
***************************************************************************************************HQIQEMEAFFKECPHPDD*QRKELSRELGLEPLQVKFWFQNKRTQMKTQHE**********N************************************************************************************************************************LAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPR***********EASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASVMATNIPTGEVGVITNQDGRKSMLKLAERMVISFCAGVSASTAHTWTTLSGTGADDVRVMTRKSV***GRPPGIVLSAATSFWLPVPPKRVFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSA*SSQSNMLILQESCTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAIL********************LTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASLSCE**
MPTGVMIPARNMPSTIGRNGNVGGLGSSSGLTLSQPTNMMEGQLHPLDMTQNTSESEIARLR*************************************HQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRT***************TENEKLRADNMRYREALSNASCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPLLSPPVPSRPLELAVGNFGAQPGIGGGEMYGAADLLRSISAPTEADKPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASVMATNIPTGEVGVITNQDGRKSMLKLAERMVISFCAGVSASTAHTWTTLSGTGADDVRVMTRKSVDDPGRPPGIVLSAATSFWLPVPPKRVFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAILPDGTSLHGANIGEAASGGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASLSCESA
*******************************************************************************************KRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKTQHERHENTQLRTENEKLRADNMRYREALSNASCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPLLS*****RPLELAVGNFGAQPGIGGGEMYGAADLLRSISAPTEADKPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASVMATNIPTGEVGVITNQDGRKSMLKLAERMVISFCAGVSASTAHTWTTLSGTGADDVRVMTRKSVDDPGRPPGIVLSAATSFWLPVPPKRVFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAILPDGT***********SGGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASLSCE**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTGVMIPARNMPSTIGRNGNVGGLGSSSGLTLSQPTNMMEGQLHPLDMTQNTSESEIARLREEEFDSTKSGSENHEGASGDDQEQRPNKKKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKTQHERHExxxxxxxxxxxxxxxxxxxxxLSNASCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPLLSPPVPSRPLELAVGNFGAQPGIGGGEMYGAADLLRSISAPTEADKPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASVMATNIPTGEVGVITNQDGRKSMLKLAERMVISFCAGVSASTAHTWTTLSGTGADDVRVMTRKSVDDPGRPPGIVLSAATSFWLPVPPKRVFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAILPDGTSLHGANIGEAASGGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASLSCESA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query760 2.2.26 [Sep-21-2011]
Q94C37721 Homeobox-leucine zipper p yes no 0.9 0.948 0.825 0.0
Q93V99743 Homeobox-leucine zipper p no no 0.942 0.963 0.755 0.0
Q0J9X2784 Homeobox-leucine zipper p yes no 0.977 0.947 0.733 0.0
Q8RWU4762 Homeobox-leucine zipper p no no 0.947 0.944 0.737 0.0
Q6ZAR0784 Homeobox-leucine zipper p no no 0.980 0.950 0.722 0.0
A2YR02749 Homeobox-leucine zipper p N/A no 0.892 0.905 0.732 0.0
A3BPF2749 Homeobox-leucine zipper p no no 0.892 0.905 0.727 0.0
Q9ZV65725 Homeobox-leucine zipper p no no 0.889 0.932 0.548 0.0
Q0WV12802 Homeobox-leucine zipper p no no 0.902 0.855 0.560 0.0
Q9M2E8808 Homeobox-leucine zipper p no no 0.943 0.887 0.514 0.0
>sp|Q94C37|HDG2_ARATH Homeobox-leucine zipper protein HDG2 OS=Arabidopsis thaliana GN=HDG2 PE=2 SV=1 Back     alignment and function desciption
 Score = 1192 bits (3083), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/706 (82%), Positives = 638/706 (90%), Gaps = 22/706 (3%)

Query: 61  LREEEFDS--TKSGSENHEGASGDDQEQ-RPNKKKRYHRHTQHQIQEMEAFFKECPHPDD 117
           LR++EFDS  TKSGSEN EG SG+DQ+   PNKKKRYHRHTQ QIQEMEAFFKECPHPDD
Sbjct: 32  LRDDEFDSPNTKSGSENQEGGSGNDQDPLHPNKKKRYHRHTQLQIQEMEAFFKECPHPDD 91

Query: 118 KQRKELSRELGLEPLQVKFWFQNKRTQMKTQHERHENTQLRTENEKLRADNMRYREALSN 177
           KQRK+LSREL LEPLQVKFWFQNKRTQMK  HERHEN+ LR ENEKLR DN+RYREAL+N
Sbjct: 92  KQRKQLSRELNLEPLQVKFWFQNKRTQMKNHHERHENSHLRAENEKLRNDNLRYREALAN 151

Query: 178 ASCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPLLSPPVPS 237
           ASCPNCGGPTAIGEMSFDEH LRLENARLREEIDRISAIAAKYVGKPV NYPL+SPP   
Sbjct: 152 ASCPNCGGPTAIGEMSFDEHQLRLENARLREEIDRISAIAAKYVGKPVSNYPLMSPPPLP 211

Query: 238 RPLEL-AVGNFGAQPGIGGGEMYG--AADLLRSISAPTEADKPMIIELAVAAMEELIRMA 294
                 A+GN G       GE YG    DLL+SI+APTE+DKP+II+L+VAAMEEL+RM 
Sbjct: 212 PRPLELAMGNIG-------GEAYGNNPNDLLKSITAPTESDKPVIIDLSVAAMEELMRMV 264

Query: 295 QMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEIL 354
           Q+ EPLW       + VL+E+EY RTFPRGIGP+P G++ EASRE+AVVIMNH+++VEIL
Sbjct: 265 QVDEPLW------KSLVLDEEEYARTFPRGIGPRPAGYRSEASRESAVVIMNHVNIVEIL 318

Query: 355 MDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYC 414
           MDVNQWST+F+G+VSRAMTL VLSTGVAGNYNGALQVM+AEFQVPSPLVPTRE+Y+ RYC
Sbjct: 319 MDVNQWSTIFAGMVSRAMTLAVLSTGVAGNYNGALQVMSAEFQVPSPLVPTRETYFARYC 378

Query: 415 KQHGEGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHN 474
           KQ G+G+WAVVD+SLD+L+P+P  RCRRR SGCLIQE+PNGYSKVTWVEHVEVDDRGVHN
Sbjct: 379 KQQGDGSWAVVDISLDSLQPNPPARCRRRASGCLIQELPNGYSKVTWVEHVEVDDRGVHN 438

Query: 475 LYKQLVSTGNAFGAKRWVATLDRQCERLASVMATNIPTGEVGVITNQDGRKSMLKLAERM 534
           LYK +VSTG+AFGAKRWVA LDRQCERLASVMATNI +GEVGVITNQ+GR+SMLKLAERM
Sbjct: 439 LYKHMVSTGHAFGAKRWVAILDRQCERLASVMATNISSGEVGVITNQEGRRSMLKLAERM 498

Query: 535 VISFCAGVSASTAHTWTTLSGTGADDVRVMTRKSVDDPGRPPGIVLSAATSFWLPVPPKR 594
           VISFCAGVSASTAHTWTTLSGTGA+DVRVMTRKSVDDPGRPPGIVLSAATSFW+PVPPKR
Sbjct: 499 VISFCAGVSASTAHTWTTLSGTGAEDVRVMTRKSVDDPGRPPGIVLSAATSFWIPVPPKR 558

Query: 595 VFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQES 654
           VFDFLRDEN+R+EWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQES
Sbjct: 559 VFDFLRDENSRNEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQES 618

Query: 655 CTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAILPDGTSLHGANIGEAASGGS 714
           CTDPTASFVIYAPVDIVAMN+VLNGGDPDYVALLPSGFAILPDG +  GA  G+   GGS
Sbjct: 619 CTDPTASFVIYAPVDIVAMNIVLNGGDPDYVALLPSGFAILPDGNANSGAPGGD---GGS 675

Query: 715 LLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASLSCESA 760
           LLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKAS+SCE+A
Sbjct: 676 LLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASMSCETA 721




Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q93V99|PDF2_ARATH Homeobox-leucine zipper protein PROTODERMAL FACTOR 2 OS=Arabidopsis thaliana GN=PDF2 PE=2 SV=1 Back     alignment and function description
>sp|Q0J9X2|ROC2_ORYSJ Homeobox-leucine zipper protein ROC2 OS=Oryza sativa subsp. japonica GN=ROC2 PE=2 SV=1 Back     alignment and function description
>sp|Q8RWU4|ATML1_ARATH Homeobox-leucine zipper protein MERISTEM L1 OS=Arabidopsis thaliana GN=ATML1 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZAR0|ROC1_ORYSJ Homeobox-leucine zipper protein ROC1 OS=Oryza sativa subsp. japonica GN=ROC1 PE=2 SV=1 Back     alignment and function description
>sp|A2YR02|ROC7_ORYSI Homeobox-leucine zipper protein ROC7 OS=Oryza sativa subsp. indica GN=ROC7 PE=3 SV=1 Back     alignment and function description
>sp|A3BPF2|ROC7_ORYSJ Homeobox-leucine zipper protein ROC7 OS=Oryza sativa subsp. japonica GN=ROC7 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZV65|HDG3_ARATH Homeobox-leucine zipper protein HDG3 OS=Arabidopsis thaliana GN=HDG3 PE=2 SV=2 Back     alignment and function description
>sp|Q0WV12|ANL2_ARATH Homeobox-leucine zipper protein ANTHOCYANINLESS 2 OS=Arabidopsis thaliana GN=ANL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2E8|HDG1_ARATH Homeobox-leucine zipper protein HDG1 OS=Arabidopsis thaliana GN=HDG1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
297739295757 unnamed protein product [Vitis vinifera] 0.993 0.997 0.901 0.0
147826488754 hypothetical protein VITISV_013736 [Viti 0.989 0.997 0.895 0.0
255566373731 homeobox protein, putative [Ricinus comm 0.956 0.994 0.916 0.0
359485664762 PREDICTED: homeobox-leucine zipper prote 0.985 0.982 0.886 0.0
224069018756 predicted protein [Populus trichocarpa] 0.989 0.994 0.891 0.0
449468346764 PREDICTED: homeobox-leucine zipper prote 0.990 0.985 0.874 0.0
224128938726 predicted protein [Populus trichocarpa] 0.952 0.997 0.905 0.0
356550018781 PREDICTED: homeobox-leucine zipper prote 0.998 0.971 0.859 0.0
356542838727 PREDICTED: homeobox-leucine zipper prote 0.951 0.994 0.882 0.0
356517624729 PREDICTED: homeobox-leucine zipper prote 0.951 0.991 0.884 0.0
>gi|297739295|emb|CBI28946.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1428 bits (3696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/762 (90%), Positives = 727/762 (95%), Gaps = 7/762 (0%)

Query: 1   MPTGVMIPARNMPSTIGRNGNVGGLGSSSGLTLSQPTNMMEGQLHPLDMTQNTSESEIAR 60
           MP G+MIPA +MPS +GRNGNV   GSSSGL+L QP NMM+GQLHPLDMTQNTSESEIAR
Sbjct: 1   MPAGIMIPATHMPSMMGRNGNVAAYGSSSGLSLGQP-NMMDGQLHPLDMTQNTSESEIAR 59

Query: 61  LREEEFDSTKSGSENHEGASGDDQE--QRPNKKKRYHRHTQHQIQEMEAFFKECPHPDDK 118
           LRE++FDS KSGSENHEGASGDDQ+  QRP KKKRYHRHTQHQIQEMEAFFKECPHPDDK
Sbjct: 60  LREDDFDS-KSGSENHEGASGDDQDPNQRP-KKKRYHRHTQHQIQEMEAFFKECPHPDDK 117

Query: 119 QRKELSRELGLEPLQVKFWFQNKRTQMKTQHERHENTQLRTENEKLRADNMRYREALSNA 178
           QRKELSRELGLEPLQVKFWFQNKRTQMKTQHERHENTQLR+ENEKLR +N+RYREALSNA
Sbjct: 118 QRKELSRELGLEPLQVKFWFQNKRTQMKTQHERHENTQLRSENEKLRTENLRYREALSNA 177

Query: 179 SCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPLLSPPVPSR 238
           SCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPL+ P VP+R
Sbjct: 178 SCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRISAIAAKYVGKPVVNYPLI-PQVPTR 236

Query: 239 PLELAVGNFGAQPGIGGGEMYGAADLLRSISAPTEADKPMIIELAVAAMEELIRMAQMGE 298
           PL+L VGNFGAQPG+GG E++GA+DLLRSI+ PTEADKPMIIELAVAAMEEL RMAQMGE
Sbjct: 237 PLDLGVGNFGAQPGLGG-ELFGASDLLRSINGPTEADKPMIIELAVAAMEELFRMAQMGE 295

Query: 299 PLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEILMDVN 358
           PLW+ SLDGT   L+EDEY+R+FPRGIGPKP GFKCEASRETAVVIMNHISLVEILMDVN
Sbjct: 296 PLWLPSLDGTTTELSEDEYIRSFPRGIGPKPPGFKCEASRETAVVIMNHISLVEILMDVN 355

Query: 359 QWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHG 418
           QWSTVFSGIVSRAMTLEVLSTGVAGNYNGA QVMTAEFQVPSPLVPTRESY+VRYCKQH 
Sbjct: 356 QWSTVFSGIVSRAMTLEVLSTGVAGNYNGAFQVMTAEFQVPSPLVPTRESYFVRYCKQHA 415

Query: 419 EGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNLYKQ 478
           +GTWAVVDVSLDNLRPSP VRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHN+YKQ
Sbjct: 416 DGTWAVVDVSLDNLRPSPVVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNIYKQ 475

Query: 479 LVSTGNAFGAKRWVATLDRQCERLASVMATNIPTGEVGVITNQDGRKSMLKLAERMVISF 538
           LV++G AFGAKRWVATLDRQCERLAS MATNIPTGEVGVIT+Q+GRKSMLKLAERMVISF
Sbjct: 476 LVNSGLAFGAKRWVATLDRQCERLASAMATNIPTGEVGVITSQEGRKSMLKLAERMVISF 535

Query: 539 CAGVSASTAHTWTTLSGTGADDVRVMTRKSVDDPGRPPGIVLSAATSFWLPVPPKRVFDF 598
           CAGVSASTAHTWTTLSG+GADDVRVMTRKSVDDPGRPPGIVLSAATSFWLPVPPKRVFDF
Sbjct: 536 CAGVSASTAHTWTTLSGSGADDVRVMTRKSVDDPGRPPGIVLSAATSFWLPVPPKRVFDF 595

Query: 599 LRDENTRSEWDILSNGGVVQEMAHIANGRDTGNCVSLLRVNSANSSQSNMLILQESCTDP 658
           LRDEN+RSEWDILSNGGVVQEMAHIANG+DTGNCVSLLRVNSANSSQSNMLILQESCTD 
Sbjct: 596 LRDENSRSEWDILSNGGVVQEMAHIANGQDTGNCVSLLRVNSANSSQSNMLILQESCTDS 655

Query: 659 TASFVIYAPVDIVAMNVVLNGGDPDYVALLPSGFAILPDGTSLHGANIGEAASGGSLLTV 718
           TASFVIYAPVD+VAMN+VLNGGDPDYVALLPSGFAILPDGT+ HG  IGE  SGGSLLTV
Sbjct: 656 TASFVIYAPVDVVAMNMVLNGGDPDYVALLPSGFAILPDGTTAHGGVIGEVGSGGSLLTV 715

Query: 719 AFQILVDSVPTAKLSLGSVATVNNLIACTVERIKASLSCESA 760
           AFQILVDSVPTAKLSLGSVATVNNLIACTV+RIKA++SCE+A
Sbjct: 716 AFQILVDSVPTAKLSLGSVATVNNLIACTVDRIKAAVSCENA 757




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147826488|emb|CAN66212.1| hypothetical protein VITISV_013736 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255566373|ref|XP_002524172.1| homeobox protein, putative [Ricinus communis] gi|223536541|gb|EEF38187.1| homeobox protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359485664|ref|XP_002273837.2| PREDICTED: homeobox-leucine zipper protein HDG2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224069018|ref|XP_002302880.1| predicted protein [Populus trichocarpa] gi|222844606|gb|EEE82153.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449468346|ref|XP_004151882.1| PREDICTED: homeobox-leucine zipper protein HDG2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224128938|ref|XP_002320458.1| predicted protein [Populus trichocarpa] gi|222861231|gb|EEE98773.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356550018|ref|XP_003543387.1| PREDICTED: homeobox-leucine zipper protein HDG2-like [Glycine max] Back     alignment and taxonomy information
>gi|356542838|ref|XP_003539872.1| PREDICTED: homeobox-leucine zipper protein HDG2-like [Glycine max] Back     alignment and taxonomy information
>gi|356517624|ref|XP_003527487.1| PREDICTED: homeobox-leucine zipper protein HDG2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query760
TAIR|locus:2207235721 HDG2 "AT1G05230" [Arabidopsis 0.926 0.976 0.801 2.3e-309
TAIR|locus:2119048762 ATML1 "AT4G21750" [Arabidopsis 0.940 0.938 0.711 1.7e-295
TAIR|locus:2135368743 PDF2 "AT4G04890" [Arabidopsis 0.942 0.963 0.749 2e-294
TAIR|locus:2127008802 ANL2 "ANTHOCYANINLESS 2" [Arab 0.909 0.861 0.559 6.7e-207
TAIR|locus:2098866808 HDG1 "AT3G61150" [Arabidopsis 0.672 0.632 0.538 1.2e-199
TAIR|locus:2062540725 HDG3 "AT2G32370" [Arabidopsis 0.903 0.947 0.535 4.2e-198
TAIR|locus:2206880722 HDG11 "AT1G73360" [Arabidopsis 0.890 0.937 0.475 2.2e-169
TAIR|locus:2145116682 HDG7 "AT5G52170" [Arabidopsis 0.539 0.601 0.493 2.9e-162
TAIR|locus:2030913687 HDG12 "homeodomain GLABROUS 12 0.877 0.970 0.464 6.5e-161
TAIR|locus:2129396709 HDG4 "AT4G17710" [Arabidopsis 0.614 0.658 0.432 7.6e-133
TAIR|locus:2207235 HDG2 "AT1G05230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2968 (1049.8 bits), Expect = 2.3e-309, P = 2.3e-309
 Identities = 584/729 (80%), Positives = 640/729 (87%)

Query:    38 NMMEGQLHPLDMTQNTSESEIARLREEEFDS--TKSGSENHEGASGDDQEQ-RPNKKKRY 94
             N  +   H  +   N +E     LR++EFDS  TKSGSEN EG SG+DQ+   PNKKKRY
Sbjct:    12 NNADSNNHNYNHEDNNNEGF---LRDDEFDSPNTKSGSENQEGGSGNDQDPLHPNKKKRY 68

Query:    95 HRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKTQHERHEN 154
             HRHTQ QIQEMEAFFKECPHPDDKQRK+LSREL LEPLQVKFWFQNKRTQMK  HERHEN
Sbjct:    69 HRHTQLQIQEMEAFFKECPHPDDKQRKQLSRELNLEPLQVKFWFQNKRTQMKNHHERHEN 128

Query:   155 TQLRTENEKLRADNMRYREALSNASCPNCGGPTAIGEMSFDEHHLRLENARLREEIDRIS 214
             + LR ENEKLR DN+RYREAL+NASCPNCGGPTAIGEMSFDEH LRLENARLREEIDRIS
Sbjct:   129 SHLRAENEKLRNDNLRYREALANASCPNCGGPTAIGEMSFDEHQLRLENARLREEIDRIS 188

Query:   215 AIAAKYVGKPVVNYXXXXXXXXXXX-XXXAVGNFGAQPGIGGGEMYG--AADLLRSISAP 271
             AIAAKYVGKPV NY               A+GN G       GE YG    DLL+SI+AP
Sbjct:   189 AIAAKYVGKPVSNYPLMSPPPLPPRPLELAMGNIG-------GEAYGNNPNDLLKSITAP 241

Query:   272 TEADKPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTG 331
             TE+DKP+II+L+VAAMEEL+RM Q+ EPLW  SL     VL+E+EY RTFPRGIGP+P G
Sbjct:   242 TESDKPVIIDLSVAAMEELMRMVQVDEPLWK-SL-----VLDEEEYARTFPRGIGPRPAG 295

Query:   332 FKCEASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQV 391
             ++ EASRE+AVVIMNH+++VEILMDVNQWST+F+G+VSRAMTL VLSTGVAGNYNGALQV
Sbjct:   296 YRSEASRESAVVIMNHVNIVEILMDVNQWSTIFAGMVSRAMTLAVLSTGVAGNYNGALQV 355

Query:   392 MTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLRPSPAVRCRRRPSGCLIQE 451
             M+AEFQVPSPLVPTRE+Y+ RYCKQ G+G+WAVVD+SLD+L+P+P  RCRRR SGCLIQE
Sbjct:   356 MSAEFQVPSPLVPTRETYFARYCKQQGDGSWAVVDISLDSLQPNPPARCRRRASGCLIQE 415

Query:   452 MPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERLASVMATNIP 511
             +PNGYSKVTWVEHVEVDDRGVHNLYK +VSTG+AFGAKRWVA LDRQCERLASVMATNI 
Sbjct:   416 LPNGYSKVTWVEHVEVDDRGVHNLYKHMVSTGHAFGAKRWVAILDRQCERLASVMATNIS 475

Query:   512 TGEVGVITNQDGRKSMLKLAERMVISFCAGVSASTAHTWTTLSGTGADDVRVMTRKSVDD 571
             +GEVGVITNQ+GR+SMLKLAERMVISFCAGVSASTAHTWTTLSGTGA+DVRVMTRKSVDD
Sbjct:   476 SGEVGVITNQEGRRSMLKLAERMVISFCAGVSASTAHTWTTLSGTGAEDVRVMTRKSVDD 535

Query:   572 PGRPPGIVLSAATSFWLPVPPKRVFDFLRDENTRSEWDILSNGGVVQEMAHIANGRDTGN 631
             PGRPPGIVLSAATSFW+PVPPKRVFDFLRDEN+R+EWDILSNGGVVQEMAHIANGRDTGN
Sbjct:   536 PGRPPGIVLSAATSFWIPVPPKRVFDFLRDENSRNEWDILSNGGVVQEMAHIANGRDTGN 595

Query:   632 CVSLLRVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNVVLNGGDPDYVALLPSG 691
             CVSLLRVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMN+VLNGGDPDYVALLPSG
Sbjct:   596 CVSLLRVNSANSSQSNMLILQESCTDPTASFVIYAPVDIVAMNIVLNGGDPDYVALLPSG 655

Query:   692 FAILPDGTSLHGANIGEAASGGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERI 751
             FAILPDG +  GA  G+   GGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERI
Sbjct:   656 FAILPDGNANSGAPGGD---GGSLLTVAFQILVDSVPTAKLSLGSVATVNNLIACTVERI 712

Query:   752 KASLSCESA 760
             KAS+SCE+A
Sbjct:   713 KASMSCETA 721




GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0010090 "trichome morphogenesis" evidence=IMP
GO:0010103 "stomatal complex morphogenesis" evidence=RCA
TAIR|locus:2119048 ATML1 "AT4G21750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2135368 PDF2 "AT4G04890" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127008 ANL2 "ANTHOCYANINLESS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098866 HDG1 "AT3G61150" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062540 HDG3 "AT2G32370" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206880 HDG11 "AT1G73360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2145116 HDG7 "AT5G52170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030913 HDG12 "homeodomain GLABROUS 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129396 HDG4 "AT4G17710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6ZAR0ROC1_ORYSJNo assigned EC number0.72270.98020.9502nono
Q8RWU4ATML1_ARATHNo assigned EC number0.73710.94730.9448nono
A3BPF2ROC7_ORYSJNo assigned EC number0.72710.89210.9052nono
Q0J9X2ROC2_ORYSJNo assigned EC number0.73390.97760.9477yesno
A2YR02ROC7_ORYSINo assigned EC number0.73260.89210.9052N/Ano
Q93V99PDF2_ARATHNo assigned EC number0.75500.94210.9636nono
Q94C37HDG2_ARATHNo assigned EC number0.82570.90.9486yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
cd08875229 cd08875, START_ArGLABRA2_like, C-terminal lipid-bi 1e-132
pfam01852205 pfam01852, START, START domain 1e-64
smart00234205 smart00234, START, in StAR and phosphatidylcholine 2e-45
pfam0004657 pfam00046, Homeobox, Homeobox domain 5e-22
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 6e-20
smart0038957 smart00389, HOX, Homeodomain 2e-18
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 2e-11
cd00177193 cd00177, START, Lipid-binding START domain of mamm 2e-07
>gnl|CDD|176884 cd08875, START_ArGLABRA2_like, C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins Back     alignment and domain information
 Score =  390 bits (1003), Expect = e-132
 Identities = 148/229 (64%), Positives = 176/229 (76%), Gaps = 4/229 (1%)

Query: 276 KPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCE 335
           K  ++ELA  AM+EL+++AQ GEPLW+ S      +LN DEY R FPR  G KP GF  E
Sbjct: 1   KSGLLELAEEAMDELLKLAQGGEPLWIKSPGMKPEILNPDEYERMFPRHGGSKPGGFTTE 60

Query: 336 ASRETAVVIMNHISLVEILMDVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAE 395
           ASR   +V+MN I LVEILMDVN+WS +F GIVS+A TL+V+STG  GN NG LQ+M AE
Sbjct: 61  ASRACGLVMMNAIKLVEILMDVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAE 120

Query: 396 FQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLR----PSPAVRCRRRPSGCLIQE 451
            QVPSPLVPTRE Y++RYCKQ  +G WAVVDVS+D ++    P+  VRCRR PSGCLIQ+
Sbjct: 121 LQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQTAPPPASFVRCRRLPSGCLIQD 180

Query: 452 MPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCE 500
           MPNGYSKVTWVEHVEVD++ VH LY+ LVS+G AFGA RWVATL RQCE
Sbjct: 181 MPNGYSKVTWVEHVEVDEKPVHLLYRYLVSSGLAFGATRWVATLQRQCE 229


This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells. Length = 229

>gnl|CDD|216740 pfam01852, START, START domain Back     alignment and domain information
>gnl|CDD|214575 smart00234, START, in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|176851 cd00177, START, Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 760
cd08875229 START_ArGLABRA2_like C-terminal lipid-binding STAR 100.0
PF01852206 START: START domain; InterPro: IPR002913 START (St 99.73
smart00234206 START in StAR and phosphatidylcholine transfer pro 99.7
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.69
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.65
KOG0488309 consensus Transcription factor BarH and related HO 99.6
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.57
KOG0494332 consensus Transcription factor CHX10 and related H 99.57
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.57
KOG0843197 consensus Transcription factor EMX1 and related HO 99.56
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.56
KOG0489261 consensus Transcription factor zerknullt and relat 99.55
KOG0850245 consensus Transcription factor DLX and related pro 99.54
KOG0848317 consensus Transcription factor Caudal, contains HO 99.51
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.48
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.46
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.44
KOG0493342 consensus Transcription factor Engrailed, contains 99.37
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.3
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.29
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.28
cd00177193 START Lipid-binding START domain of mammalian STAR 99.28
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.26
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.26
COG5576156 Homeodomain-containing transcription factor [Trans 99.23
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.23
KOG0847288 consensus Transcription factor, contains HOX domai 99.2
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.14
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.13
cd08871222 START_STARD10-like Lipid-binding START domain of m 99.09
cd08867206 START_STARD4_5_6-like Lipid-binding START domain o 99.0
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 98.99
KOG0490235 consensus Transcription factor, contains HOX domai 98.89
cd08903208 START_STARD5-like Lipid-binding START domain of ma 98.79
cd08904204 START_STARD6-like Lipid-binding START domain of ma 98.78
KOG0849354 consensus Transcription factor PRD and related pro 98.68
cd08909205 START_STARD13-like C-terminal lipid-binding START 98.64
cd08869197 START_RhoGAP C-terminal lipid-binding START domain 98.56
cd08905209 START_STARD1-like Cholesterol-binding START domain 98.53
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.51
PLN00188719 enhanced disease resistance protein (EDR2); Provis 98.39
cd08906209 START_STARD3-like Cholesterol-binding START domain 98.32
KOG0775304 consensus Transcription factor SIX and related HOX 98.25
cd08902202 START_STARD4-like Lipid-binding START domain of ma 98.22
cd08874205 START_STARD9-like C-terminal START domain of mamma 98.1
cd08908204 START_STARD12-like C-terminal lipid-binding START 98.07
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 98.05
cd08910207 START_STARD2-like Lipid-binding START domain of ma 97.97
cd08870209 START_STARD2_7-like Lipid-binding START domain of 97.96
KOG0774334 consensus Transcription factor PBX and related HOX 97.89
cd08877215 START_2 Uncharacterized subgroup of the steroidoge 97.85
cd08907205 START_STARD8-like C-terminal lipid-binding START d 97.78
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.77
KOG2252558 consensus CCAAT displacement protein and related h 97.7
cd08911207 START_STARD7-like Lipid-binding START domain of ma 97.57
KOG0490235 consensus Transcription factor, contains HOX domai 97.41
cd08872235 START_STARD11-like Ceramide-binding START domain o 97.35
cd08873235 START_STARD14_15-like Lipid-binding START domain o 97.2
cd08869197 START_RhoGAP C-terminal lipid-binding START domain 96.84
cd08914236 START_STARD15-like Lipid-binding START domain of m 96.64
cd08871222 START_STARD10-like Lipid-binding START domain of m 96.64
cd08913240 START_STARD14-like Lipid-binding START domain of m 96.57
KOG11461406 consensus Homeobox protein [General function predi 96.3
cd08907205 START_STARD8-like C-terminal lipid-binding START d 96.02
cd08904204 START_STARD6-like Lipid-binding START domain of ma 95.43
cd08874205 START_STARD9-like C-terminal START domain of mamma 95.27
KOG0773342 consensus Transcription factor MEIS1 and related H 95.09
cd08868208 START_STARD1_3_like Cholesterol-binding START doma 95.06
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 94.62
cd08877215 START_2 Uncharacterized subgroup of the steroidoge 94.61
cd00177193 START Lipid-binding START domain of mammalian STAR 94.46
smart00234206 START in StAR and phosphatidylcholine transfer pro 94.2
cd08903208 START_STARD5-like Lipid-binding START domain of ma 94.16
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 93.85
cd08876195 START_1 Uncharacterized subgroup of the steroidoge 93.3
cd08909205 START_STARD13-like C-terminal lipid-binding START 93.21
KOG4196135 consensus bZIP transcription factor MafK [Transcri 92.87
cd08873235 START_STARD14_15-like Lipid-binding START domain o 92.55
cd08908204 START_STARD12-like C-terminal lipid-binding START 92.48
cd08867206 START_STARD4_5_6-like Lipid-binding START domain o 92.41
PRK09413121 IS2 repressor TnpA; Reviewed 92.01
cd08914236 START_STARD15-like Lipid-binding START domain of m 91.36
cd08906209 START_STARD3-like Cholesterol-binding START domain 90.31
cd08902202 START_STARD4-like Lipid-binding START domain of ma 89.88
cd08866144 SRPBCC_11 Ligand-binding SRPBCC domain of an uncha 89.64
cd08860146 TcmN_ARO-CYC_like N-terminal aromatase/cyclase dom 89.38
cd08875229 START_ArGLABRA2_like C-terminal lipid-binding STAR 89.16
cd08870209 START_STARD2_7-like Lipid-binding START domain of 89.06
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 88.06
cd05018144 CoxG Carbon monoxide dehydrogenase subunit G (CoxG 87.59
KOG36231007 consensus Homeobox transcription factor SIP1 [Tran 87.16
cd07821140 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), 86.95
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 86.95
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 86.41
cd07813138 COQ10p_like Coenzyme Q-binding protein COQ10p and 86.26
PF01852206 START: START domain; InterPro: IPR002913 START (St 86.03
KOG2761219 consensus START domain-containing proteins involve 85.09
PRK1542279 septal ring assembly protein ZapB; Provisional 84.37
cd07819140 SRPBCC_2 Ligand-binding SRPBCC domain of an unchar 84.23
cd08864208 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand- 83.74
cd07817139 SRPBCC_8 Ligand-binding SRPBCC domain of an unchar 83.42
cd08861142 OtcD1_ARO-CYC_like N-terminal and C-terminal aroma 83.17
cd08910207 START_STARD2-like Lipid-binding START domain of ma 82.27
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 80.76
>cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins Back     alignment and domain information
Probab=100.00  E-value=2.2e-90  Score=707.79  Aligned_cols=225  Identities=66%  Similarity=1.088  Sum_probs=219.9

Q ss_pred             hHHHHHHHHHHHHHHHHhhcCCCCceeecCCCCccccChHHHhhcCCCCCCCCCCCCcceeeecceEEEechhhHHHHhc
Q 004332          276 KPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEILM  355 (760)
Q Consensus       276 ~~~~~~lA~~Am~El~~la~~~eplWi~~~~~~~e~Ln~~eY~~~fp~~~g~~~~g~~~EAsR~~g~V~~~~~~LVe~lm  355 (760)
                      |++|++||++||+||++||++++|||++++++++|+||+|||.++||+..|+++.||++|||||||+|+||+.+|||+||
T Consensus         1 k~~~~~lA~~am~Ell~~a~~~~plWi~~~~~~~~~l~~dey~~~f~~~~~~~~~~~~~eASR~~glV~m~~~~lVe~lm   80 (229)
T cd08875           1 KSGLLELAEEAMDELLKLAQGGEPLWIKSPGMKPEILNPDEYERMFPRHGGSKPGGFTTEASRACGLVMMNAIKLVEILM   80 (229)
T ss_pred             ChHHHHHHHHHHHHHHHHhccCCCCceecCCCCccccCHHHHhhcccCcCCCCCCCCeEEEEeeeEEEecCHHHHHHHHh
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ChhhHhhhhccccccceEeeEeecccCCCCCCeeeeeehhhhcCCCCccCceeEEEEeeeeeCCceEEEEEEecCCCC--
Q 004332          356 DVNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTAEFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDVSLDNLR--  433 (760)
Q Consensus       356 D~~~W~~~Fp~iVs~a~t~~Vis~g~~g~~~G~lqlm~aEl~v~SPLvp~Re~~fLRyckq~~~g~w~VvDvS~d~~~--  433 (760)
                      |+++|.++||+||++|+|++||++|.+|++||+|||||+|||+||||||+|||||||||||++||+|||||||+|+.+  
T Consensus        81 D~~kW~~~Fp~iv~~a~tl~vistg~~g~~~G~lqlmyael~~pSpLVp~Re~~fLRyc~~l~dG~w~VvdvSld~~~~~  160 (229)
T cd08875          81 DVNKWSELFPGIVSKAKTLQVISTGNGGNRNGTLQLMYAELQVPSPLVPTREFYFLRYCKQLEDGLWAVVDVSIDGVQTA  160 (229)
T ss_pred             ChhhhhhhhhhhcceeeEEEEeeCCCCCCCCceehhhhhhcccCcccccCCeEEEEEEEEEeCCCeEEEEEEeecccccC
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999999874  


Q ss_pred             --CCCCcceeecCccceEEecCCCceEEEEEEeeeecCcccchhhHhhhhchhhHHHHHHHHHHHHHHH
Q 004332          434 --PSPAVRCRRRPSGCLIQEMPNGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCE  500 (760)
Q Consensus       434 --~~~~~~~~rlPSGclIq~~~nG~skVtwVeH~e~d~~~vh~l~rpl~~Sg~afgA~rWla~LqR~ce  500 (760)
                        ..+++||||+|||||||||+|||||||||||+|||++.+|.+||++++||+||||+||+++||||||
T Consensus       161 p~~~~~~r~~~~PSGcLIq~~~nG~SkVtwVeH~e~d~~~~~~l~~~l~~sg~AfgA~rw~a~lqRqce  229 (229)
T cd08875         161 PPPASFVRCRRLPSGCLIQDMPNGYSKVTWVEHVEVDEKPVHLLYRYLVSSGLAFGATRWVATLQRQCE  229 (229)
T ss_pred             CCCCCccEEEEecCcEEEEECCCCceEEEEEEEEeccCCcccccchhhhhhhHHHHHHHHHHHHHHhcC
Confidence              3368999999999999999999999999999999999999999999999999999999999999997



This subfamily includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of the Arabidopsis homeobox protein GLABRA 2 and related proteins. The START domain family belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Most proteins in this subgroup contain an N-terminal homeobox DNA-binding domain, some contain a leucine zipper. ArGLABRA2 plays a role in the differentiation of hairless epidermal cells of the Arabidopsis root. It acts in a cell-position-dependent manner to suppress root hair formation in those cells.

>PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins Back     alignment and domain information
>cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08905 START_STARD1-like Cholesterol-binding START domain of mammalian STARD1 and related proteins Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>PLN00188 enhanced disease resistance protein (EDR2); Provisional Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins Back     alignment and domain information
>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>cd08911 START_STARD7-like Lipid-binding START domain of mammalian STARD7 and related proteins Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>cd08872 START_STARD11-like Ceramide-binding START domain of mammalian STARD11 and related domains Back     alignment and domain information
>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins Back     alignment and domain information
>cd08869 START_RhoGAP C-terminal lipid-binding START domain of mammalian STARD8, -12, -13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins Back     alignment and domain information
>cd08871 START_STARD10-like Lipid-binding START domain of mammalian STARD10 and related proteins Back     alignment and domain information
>cd08913 START_STARD14-like Lipid-binding START domain of mammalian STARDT14 and related proteins Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>cd08907 START_STARD8-like C-terminal lipid-binding START domain of mammalian STARD8 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08904 START_STARD6-like Lipid-binding START domain of mammalian STARD6 and related proteins Back     alignment and domain information
>cd08874 START_STARD9-like C-terminal START domain of mammalian STARD9, and related domains; lipid binding Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>cd08868 START_STARD1_3_like Cholesterol-binding START domain of mammalian STARD1, -3 and related proteins Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>cd08877 START_2 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd00177 START Lipid-binding START domain of mammalian STARD1-STARD15 and related proteins Back     alignment and domain information
>smart00234 START in StAR and phosphatidylcholine transfer protein Back     alignment and domain information
>cd08903 START_STARD5-like Lipid-binding START domain of mammalian STARD5 and related proteins Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>cd08876 START_1 Uncharacterized subgroup of the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domain family Back     alignment and domain information
>cd08909 START_STARD13-like C-terminal lipid-binding START domain of mammalian STARD13 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>cd08873 START_STARD14_15-like Lipid-binding START domain of mammalian STARDT14, -15, and related proteins Back     alignment and domain information
>cd08908 START_STARD12-like C-terminal lipid-binding START domain of mammalian STARD12 and related proteins, which also have an N-terminal Rho GTPase-activating protein (RhoGAP) domain Back     alignment and domain information
>cd08867 START_STARD4_5_6-like Lipid-binding START domain of mammalian STARD4, -5, -6, and related proteins Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins Back     alignment and domain information
>cd08906 START_STARD3-like Cholesterol-binding START domain of mammalian STARD3 and related proteins Back     alignment and domain information
>cd08902 START_STARD4-like Lipid-binding START domain of mammalian STARD4 and related proteins Back     alignment and domain information
>cd08866 SRPBCC_11 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08860 TcmN_ARO-CYC_like N-terminal aromatase/cyclase domain of the multifunctional protein tetracenomycin (TcmN) and related domains Back     alignment and domain information
>cd08875 START_ArGLABRA2_like C-terminal lipid-binding START domain of the Arabidopsis homeobox protein GLABRA 2 and related proteins Back     alignment and domain information
>cd08870 START_STARD2_7-like Lipid-binding START domain of mammalian STARD2, -7, and related proteins Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>cd05018 CoxG Carbon monoxide dehydrogenase subunit G (CoxG) Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>cd07821 PYR_PYL_RCAR_like Pyrabactin resistance 1 (PYR1), PYR1-like (PYL), regulatory component of abscisic acid receptors (RCARs), and related proteins Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>cd07813 COQ10p_like Coenzyme Q-binding protein COQ10p and similar proteins Back     alignment and domain information
>PF01852 START: START domain; InterPro: IPR002913 START (StAR-related lipid-transfer) is a lipid-binding domain in StAR, HD-ZIP and signalling proteins [] Back     alignment and domain information
>KOG2761 consensus START domain-containing proteins involved in steroidogenesis/phosphatidylcholine transfer [Lipid transport and metabolism] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>cd07819 SRPBCC_2 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08864 SRPBCC_DUF3074 DUF3074, an uncharacterized ligand-binding domain of the SRPBCC domain superfamily Back     alignment and domain information
>cd07817 SRPBCC_8 Ligand-binding SRPBCC domain of an uncharacterized subfamily of proteins Back     alignment and domain information
>cd08861 OtcD1_ARO-CYC_like N-terminal and C-terminal aromatase/cyclase domains of Streptomyces rimosus OtcD1 and related domains Back     alignment and domain information
>cd08910 START_STARD2-like Lipid-binding START domain of mammalian STARD2 and related proteins Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 3e-06
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 1e-05
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 7e-05
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 7e-05
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 8e-05
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 1e-04
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 1e-04
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 1e-04
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 3e-04
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 3e-04
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 3e-04
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 3e-04
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 4e-04
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 4e-04
2p81_A44 Engrailed Homeodomain Helix-Turn-Helix Motif Length 4e-04
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 4e-04
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 5e-04
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 6e-04
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 6e-04
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 7e-04
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 8e-04
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 8e-04
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure

Iteration: 1

Score = 50.8 bits (120), Expect = 3e-06, Method: Composition-based stats. Identities = 22/65 (33%), Positives = 40/65 (61%), Gaps = 2/65 (3%) Query: 88 PNKKKRYHR--HTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQM 145 P +K+R +R T Q++E+E F +PD R+EL+ ++GL +++ WFQN+R + Sbjct: 2 PKRKQRRYRTTFTSFQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKW 61 Query: 146 KTQHE 150 + Q + Sbjct: 62 RKQEK 66
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|2P81|A Chain A, Engrailed Homeodomain Helix-Turn-Helix Motif Length = 44 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query760
3d1n_I151 POU domain, class 6, transcription factor 1; prote 4e-24
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 4e-22
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 4e-19
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 5e-19
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-18
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 2e-18
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 5e-17
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-16
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 6e-16
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-15
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-15
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-15
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-14
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 7e-14
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 4e-13
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 5e-13
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-12
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-11
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 1e-11
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-11
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 4e-11
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 6e-11
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 1e-10
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-10
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 1e-10
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 1e-10
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-10
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-10
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-10
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 4e-10
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 4e-10
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 8e-10
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-09
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 1e-09
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 2e-09
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 2e-09
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-09
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 4e-09
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 4e-09
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 6e-09
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 7e-09
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 7e-09
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 8e-09
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 1e-08
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-08
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 4e-08
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 5e-08
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 5e-08
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 6e-08
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-07
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 2e-07
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-07
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 3e-07
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 3e-07
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 4e-07
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 5e-07
1uhs_A72 HOP, homeodomain only protein; structural genomics 1e-06
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-06
1lfb_A99 Liver transcription factor (LFB1); transcription r 2e-06
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 2e-05
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 4e-04
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 3e-05
1wh5_A80 ZF-HD homeobox family protein; structural genomics 5e-05
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 8e-05
2e19_A64 Transcription factor 8; homeobox domain, structura 1e-04
2pso_A237 STAR-related lipid transfer protein 13; alpha and 2e-04
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 6e-04
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 6e-04
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 7e-04
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 8e-04
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
 Score = 98.2 bits (244), Expect = 4e-24
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 4/129 (3%)

Query: 20  GNVG-GLGSSSGLTLSQPTNMMEGQLHPLDMTQNTSESEIARLREEEFDSTKSGSENHEG 78
             VG  + ++ G   SQ       +   LD+T  +++     L +   ++     E  + 
Sbjct: 25  TQVGQAMTATEGPAYSQSA---ISRFEKLDITPKSAQKLKPVLEKWLNEAELRNQEGQQN 81

Query: 79  ASGDDQEQRPNKKKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWF 138
                  +   K+KR    T   I+ + A+F++ P P  ++  E+++EL  +   V+ WF
Sbjct: 82  LMEFVGGEPSKKRKRRTSFTPQAIEALNAYFEKNPLPTGQEITEMAKELNYDREVVRVWF 141

Query: 139 QNKRTQMKT 147
            N+R  +K 
Sbjct: 142 SNRRQTLKN 150


>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Length = 224 Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Length = 224 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Length = 237 Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Length = 231 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} Length = 67 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 99.82
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.69
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.69
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.69
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.69
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.67
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.67
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.66
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.66
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.66
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.65
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.65
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.65
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.65
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.64
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.64
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.64
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.64
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.64
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.64
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.64
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.64
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.63
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.63
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.63
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.63
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.63
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.63
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.62
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.62
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.62
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.61
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.61
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.61
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.61
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.61
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.61
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.6
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.6
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.6
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.6
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.6
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.58
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.58
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.58
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.57
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.57
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.57
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.56
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.56
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.56
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.55
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.55
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.55
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.54
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.53
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.53
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.53
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.53
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.52
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.52
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.52
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.51
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.51
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.5
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.49
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.49
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.47
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.47
2e19_A64 Transcription factor 8; homeobox domain, structura 99.46
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.45
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.42
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.39
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.27
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 99.25
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 99.21
2pso_A237 STAR-related lipid transfer protein 13; alpha and 99.2
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.17
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.12
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.08
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.0
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 98.99
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 98.99
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 98.73
3qsz_A189 STAR-related lipid transfer protein; structural ge 98.62
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.5
2e3n_A255 Lipid-transfer protein CERT; ceramide transfer, li 98.37
2r55_A231 STAR-related lipid transfer protein 5; alpha and b 96.85
1jss_A224 Stard4, cholesterol-regulated start protein 4; sta 96.04
3qsz_A189 STAR-related lipid transfer protein; structural ge 95.76
2pso_A237 STAR-related lipid transfer protein 13; alpha and 95.63
3p0l_A221 Steroidogenic acute regulatory protein, mitochond; 95.49
2d4r_A147 Hypothetical protein TTHA0849; start domain, struc 95.48
1em2_A229 MLN64 protein; beta barrel, lipid binding protein; 95.02
1ln1_A214 PC-TP, phosphatidylcholine transfer protein; start 94.61
3fo5_A258 Thioesterase, adipose associated, isoform BFIT2; o 94.13
3tfz_A172 Cyclase; helix-GRIP, BET V1-like superfamily, bios 91.11
3tvq_A169 Multifunctional cyclase-dehydratase-3-O-methyl TR 90.92
1t17_A148 Conserved hypothetical protein; beta-alpha-beta-BE 90.57
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 89.14
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 88.11
3tl1_A159 WHIE ORF VI, polyketide cyclase; helix-GRIP fold, 86.46
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 86.14
3p9v_A161 Uncharacterized protein; structural genomics, PSI- 85.99
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 85.34
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 84.59
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 81.43
2wt7_B90 Transcription factor MAFB; transcription, transcri 81.2
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
Probab=99.82  E-value=1.8e-19  Score=183.37  Aligned_cols=200  Identities=15%  Similarity=0.212  Sum_probs=156.6

Q ss_pred             CChHHHHHHHHHHHHHHHHhhcCCCCceeecCCCCccccChHHHhhcCCCCCCCCCCCCcceeeecceEEEechhhHHHH
Q 004332          274 ADKPMIIELAVAAMEELIRMAQMGEPLWMTSLDGTAAVLNEDEYVRTFPRGIGPKPTGFKCEASRETAVVIMNHISLVEI  353 (760)
Q Consensus       274 ~~~~~~~~lA~~Am~El~~la~~~eplWi~~~~~~~e~Ln~~eY~~~fp~~~g~~~~g~~~EAsR~~g~V~~~~~~LVe~  353 (760)
                      .+++.++++|++||+||+++++. +..|....+.        ++.+.|.+..    .+..+.+.|..|+|.+++.+|++.
T Consensus        19 ~~~~~y~~~a~~~~~~~l~~~~~-~~~W~~~~~~--------~gv~v~~~~~----~~~~~~~~k~~~~v~~~~~~v~~~   85 (231)
T 2r55_A           19 YFQSMAAQMSEAVAEKMLQYRRD-TAGWKICREG--------NGVSVSWRPS----VEFPGNLYRGEGIVYGTLEEVWDC   85 (231)
T ss_dssp             -CHHHHHHHHHHHHHHHHHHHHC-CSSCEEEECC--------SSEEEEEEEC----SSSSSEEEEEEEEESSCHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHHHhcC-CCCCEEEEeC--------CCEEEEEEcc----CCCCCcEEEEEEEECCCHHHHHHH
Confidence            35889999999999999999975 4789876431        2233432211    122347889999999999999999


Q ss_pred             hcC-----hhhHhhhhccccccceEeeEeecccCCCCCCeeeeeeh-hhhcCCCCccCceeEEEEeeeeeCCceEEEEEE
Q 004332          354 LMD-----VNQWSTVFSGIVSRAMTLEVLSTGVAGNYNGALQVMTA-EFQVPSPLVPTRESYYVRYCKQHGEGTWAVVDV  427 (760)
Q Consensus       354 lmD-----~~~W~~~Fp~iVs~a~t~~Vis~g~~g~~~G~lqlm~a-El~v~SPLvp~Re~~fLRyckq~~~g~w~VvDv  427 (760)
                      ||+     +.+|-..|.    .++.++.|+.      +  -.++|. ....++++|++|||.++||+++.++|.|+|+.+
T Consensus        86 l~~~d~~~r~~Wd~~~~----~~~vle~i~~------~--~~i~~~~~~~~~~~~v~~RDfv~~r~~~~~~~g~~vi~~~  153 (231)
T 2r55_A           86 VKPAVGGLRVKWDENVT----GFEIIQSITD------T--LCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNAT  153 (231)
T ss_dssp             HCC--CCSHHHHCTTCS----EEEEEEECSS------S--EEEEEEECCCBTTTTBCCEEEEEEEEEEECTTSCEEEEEE
T ss_pred             HHhhCcchhhhhccccc----eeEEEEEcCC------C--EEEEEEEeccccCCccCCCeEEEEEEEEEcCCCEEEEEEE
Confidence            977     899988874    5566666651      1  233442 223456799999999999999999999999999


Q ss_pred             ecCCCC-C--CCCcceeecCccceEEecC--CCceEEEEEEeeeecCcccchhhHhhhhchhhHHHHHHHHHHHHHHHHH
Q 004332          428 SLDNLR-P--SPAVRCRRRPSGCLIQEMP--NGYSKVTWVEHVEVDDRGVHNLYKQLVSTGNAFGAKRWVATLDRQCERL  502 (760)
Q Consensus       428 S~d~~~-~--~~~~~~~rlPSGclIq~~~--nG~skVtwVeH~e~d~~~vh~l~rpl~~Sg~afgA~rWla~LqR~cerl  502 (760)
                      |++.-. |  ..++|++.++|||+||+++  +|.|+|||+.|++..-+ +|   +.++++.++.++..|++.|+++|+.+
T Consensus       154 Sv~~~~~P~~~~~VR~~~~~~g~~i~p~~~~~~~t~vt~~~~~Dp~G~-iP---~~lvn~~~~~~~~~~~~~Lr~~~~~~  229 (231)
T 2r55_A          154 HVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGY-LP---QNVVDSFFPRSMTRFYANLQKAVKQF  229 (231)
T ss_dssp             ECCCTTSCCCTTCEEEEECSEEEEEEECC--CCCEEEEEEECEECCSS-CC---HHHHHHHHHHHHHHHHHHHHHHHHGG
T ss_pred             eccCCCCCCCCCCEEEEEEeeEEEEEEeCCCCCcEEEEEEEEeCCCCC-cc---HHHHHHHHhHhHHHHHHHHHHHHHHh
Confidence            998432 1  2679999999999999998  78999999999998876 55   67899999999999999999999853



>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2e3n_A Lipid-transfer protein CERT; ceramide transfer, lipid transport; HET: 6CM; 1.40A {Homo sapiens} PDB: 2e3m_A* 2e3o_A* 2e3p_A* 2e3q_A* 2e3r_A* 2e3s_A 2z9y_A* 3h3q_A* 3h3r_A* 3h3s_A* 3h3t_A* 2z9z_A* Back     alignment and structure
>2r55_A STAR-related lipid transfer protein 5; alpha and beta protein, cholesterol binding, structural GENO structural genomics consortium, SGC; 2.50A {Homo sapiens} Back     alignment and structure
>1jss_A Stard4, cholesterol-regulated start protein 4; start domain, structural genomics, PSI, protein structure initiative; 2.20A {Mus musculus} SCOP: d.129.3.2 Back     alignment and structure
>3qsz_A STAR-related lipid transfer protein; structural genomics, PSI-biology; 2.39A {Xanthomonas axonopodis PV} Back     alignment and structure
>2pso_A STAR-related lipid transfer protein 13; alpha and beta protein, lipid binding, helix swapping, struc genomics, structural genomics consortium, SGC; 2.80A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>3p0l_A Steroidogenic acute regulatory protein, mitochond; structural genomics consortium, SGC, start domain, cholester transport, cholesterol; 3.40A {Homo sapiens} Back     alignment and structure
>2d4r_A Hypothetical protein TTHA0849; start domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.40A {Thermus thermophilus} SCOP: d.129.3.6 Back     alignment and structure
>1em2_A MLN64 protein; beta barrel, lipid binding protein; HET: TAR; 2.20A {Homo sapiens} SCOP: d.129.3.2 Back     alignment and structure
>1ln1_A PC-TP, phosphatidylcholine transfer protein; start domain, lipid binding protein; HET: DLP; 2.40A {Homo sapiens} SCOP: d.129.3.2 PDB: 1ln2_A* 1ln3_A* Back     alignment and structure
>3fo5_A Thioesterase, adipose associated, isoform BFIT2; orthogonal bundle, consortium, lipid transport; HET: 1PE TCE; 2.00A {Homo sapiens} Back     alignment and structure
>3tfz_A Cyclase; helix-GRIP, BET V1-like superfamily, biosynthetic protein; HET: CXS; 2.39A {Streptomyces SP} Back     alignment and structure
>3tvq_A Multifunctional cyclase-dehydratase-3-O-methyl TR TCMN; tetracenomycin, aromatase, taxifolin, dihyroquercet helix-GRIP fold; HET: DQH; 1.67A {Streptomyces glaucescens} PDB: 2rer_A 2res_A 2rez_A Back     alignment and structure
>1t17_A Conserved hypothetical protein; beta-alpha-beta-BETA-beta-BETA-beta-BETA-helix, structural G protein structure initiative, PSI, NESG; NMR {Caulobacter crescentus} SCOP: d.129.3.6 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>3tl1_A WHIE ORF VI, polyketide cyclase; helix-GRIP fold, polyketide C9-C14 aromatase/cyclase, linear beta-ketone intermediate; HET: JRO; 1.80A {Streptomyces coelicolor} PDB: 3tvr_A 2kf2_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3p9v_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.78A {Marinobacter aquaeolei} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 760
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 5e-19
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 5e-18
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 1e-17
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 3e-17
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-17
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 4e-17
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 2e-16
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 6e-16
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 8e-16
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 5e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 9e-15
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 1e-14
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 1e-14
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-14
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 5e-14
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 5e-14
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 6e-14
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 1e-13
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-13
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-13
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 2e-13
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 4e-13
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 4e-13
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 6e-13
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-12
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 8e-12
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 2e-11
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 8e-11
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 9e-11
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-10
d2psoa1197 d.129.3.2 (A:908-1104) Star-related lipid transfer 5e-04
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 79.9 bits (197), Expect = 5e-19
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 80  SGDDQEQRPNKKKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQ 139
           + +    R  +KKR   +T+HQ  E+E  F    +    +R E++R L L   QVK WFQ
Sbjct: 4   AANWLHARSTRKKR-CPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQ 62

Query: 140 NKRTQMKTQHE 150
           N+R +MK  ++
Sbjct: 63  NRRMKMKKINK 73


>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Length = 197 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query760
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.72
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.72
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.71
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.71
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.71
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.7
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.7
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.69
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.68
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.67
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.67
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.67
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.66
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.66
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.65
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.62
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.62
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.61
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.61
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.59
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.58
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.58
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.57
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.51
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.51
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.48
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.45
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.43
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.41
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.4
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.31
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 98.99
d2psoa1197 Star-related lipid transfer protein 13 {Human (Hom 98.65
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 98.5
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo 98.44
d1em2a_214 Lipid transport domain of Mln64 {Human (Homo sapie 95.72
d2psoa1197 Star-related lipid transfer protein 13 {Human (Hom 95.16
d1jssa_199 Cholesterol-regulated Start protein 4 (Stard4). {M 94.96
d1ln1a_203 Phosphatidylcholine transfer protein {Human (Homo 92.88
d2d4ra1146 Hypothetical protein TTHA0849 {Thermus thermophilu 92.49
d2rera1155 Multifunctional enzyme TcmN, cyclase/aromatase dom 91.53
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 85.25
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.72  E-value=1.2e-18  Score=140.83  Aligned_cols=57  Identities=25%  Similarity=0.446  Sum_probs=55.0

Q ss_pred             CCCCCCCChHHHHHHHHHHhcCCCCCHHHHHHHHHHhCCCchhhhcccccchhhHHH
Q 004332           91 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKT  147 (760)
Q Consensus        91 kr~RtrfT~~Ql~~LE~~F~~~~~Ps~~~R~~LA~~LgL~~rQVkvWFQNRRaK~Kr  147 (760)
                      ||+|+.||.+|+.+||..|..++||+..+|.+||..|||+++||++||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            667899999999999999999999999999999999999999999999999999985



>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1em2a_ d.129.3.2 (A:) Lipid transport domain of Mln64 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2psoa1 d.129.3.2 (A:908-1104) Star-related lipid transfer protein 13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jssa_ d.129.3.2 (A:) Cholesterol-regulated Start protein 4 (Stard4). {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ln1a_ d.129.3.2 (A:) Phosphatidylcholine transfer protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d4ra1 d.129.3.6 (A:2-147) Hypothetical protein TTHA0849 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2rera1 d.129.3.6 (A:1-155) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure