BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 004397
(756 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1VM8|A Chain A, Crystal Structure Of Udp-N-Acetylglucosamine
Pyrophosphorylase (Agx2) From Mus Musculus At 2.50 A
Resolution
pdb|1VM8|B Chain B, Crystal Structure Of Udp-N-Acetylglucosamine
Pyrophosphorylase (Agx2) From Mus Musculus At 2.50 A
Resolution
Length = 534
Score = 30.4 bits (67), Expect = 3.5, Method: Compositional matrix adjust.
Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)
Query: 686 RDIEAVDKAWEAGAVHLIGENEV-VAAEGAGIGKRLMINYAFNFLKKNLRGSETVFDIPH 744
RD E + +AWE+ + I +N+V V G G RL ++Y L +T+F I
Sbjct: 94 RDQEQL-QAWESEGLSQISQNKVAVLLLAGGQGTRLGVSYPKGXYDVGLPSHKTLFQIQA 152
Query: 745 KRMVKVGMTYE 755
+R++K+ E
Sbjct: 153 ERILKLQQLAE 163
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.140 0.416
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,043,764
Number of Sequences: 62578
Number of extensions: 842590
Number of successful extensions: 1600
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1600
Number of HSP's gapped (non-prelim): 2
length of query: 756
length of database: 14,973,337
effective HSP length: 106
effective length of query: 650
effective length of database: 8,340,069
effective search space: 5421044850
effective search space used: 5421044850
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 55 (25.8 bits)