BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 004397
         (756 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1VM8|A Chain A, Crystal Structure Of Udp-N-Acetylglucosamine
           Pyrophosphorylase (Agx2) From Mus Musculus At 2.50 A
           Resolution
 pdb|1VM8|B Chain B, Crystal Structure Of Udp-N-Acetylglucosamine
           Pyrophosphorylase (Agx2) From Mus Musculus At 2.50 A
           Resolution
          Length = 534

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 2/71 (2%)

Query: 686 RDIEAVDKAWEAGAVHLIGENEV-VAAEGAGIGKRLMINYAFNFLKKNLRGSETVFDIPH 744
           RD E + +AWE+  +  I +N+V V     G G RL ++Y        L   +T+F I  
Sbjct: 94  RDQEQL-QAWESEGLSQISQNKVAVLLLAGGQGTRLGVSYPKGXYDVGLPSHKTLFQIQA 152

Query: 745 KRMVKVGMTYE 755
           +R++K+    E
Sbjct: 153 ERILKLQQLAE 163


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,043,764
Number of Sequences: 62578
Number of extensions: 842590
Number of successful extensions: 1600
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1600
Number of HSP's gapped (non-prelim): 2
length of query: 756
length of database: 14,973,337
effective HSP length: 106
effective length of query: 650
effective length of database: 8,340,069
effective search space: 5421044850
effective search space used: 5421044850
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 55 (25.8 bits)