BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 004424
(754 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3ABZ|A Chain A, Crystal Structure Of Se-Met Labeled Beta-Glucosidase From
Kluyveromyces Marxianus
pdb|3ABZ|B Chain B, Crystal Structure Of Se-Met Labeled Beta-Glucosidase From
Kluyveromyces Marxianus
pdb|3ABZ|C Chain C, Crystal Structure Of Se-Met Labeled Beta-Glucosidase From
Kluyveromyces Marxianus
pdb|3ABZ|D Chain D, Crystal Structure Of Se-Met Labeled Beta-Glucosidase From
Kluyveromyces Marxianus
Length = 845
Score = 33.5 bits (75), Expect = 0.47, Method: Compositional matrix adjust.
Identities = 16/39 (41%), Positives = 21/39 (53%)
Query: 360 IGYRNYSKLYVSVIFAYIYGLSFATLMASISHVALFEGK 398
+GYR Y KL V F + YGLS+ T IS + + K
Sbjct: 698 VGYRYYEKLQRKVAFPFGYGLSYTTFELDISDFKVTDDK 736
>pdb|3AC0|A Chain A, Crystal Structure Of Beta-Glucosidase From Kluyveromyces
Marxianus In Complex With Glucose
pdb|3AC0|B Chain B, Crystal Structure Of Beta-Glucosidase From Kluyveromyces
Marxianus In Complex With Glucose
pdb|3AC0|C Chain C, Crystal Structure Of Beta-Glucosidase From Kluyveromyces
Marxianus In Complex With Glucose
pdb|3AC0|D Chain D, Crystal Structure Of Beta-Glucosidase From Kluyveromyces
Marxianus In Complex With Glucose
Length = 845
Score = 33.5 bits (75), Expect = 0.51, Method: Compositional matrix adjust.
Identities = 16/39 (41%), Positives = 21/39 (53%)
Query: 360 IGYRNYSKLYVSVIFAYIYGLSFATLMASISHVALFEGK 398
+GYR Y KL V F + YGLS+ T IS + + K
Sbjct: 698 VGYRYYEKLQRKVAFPFGYGLSYTTFELDISDFKVTDDK 736
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.141 0.459
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,399,624
Number of Sequences: 62578
Number of extensions: 994636
Number of successful extensions: 2349
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 2347
Number of HSP's gapped (non-prelim): 4
length of query: 754
length of database: 14,973,337
effective HSP length: 106
effective length of query: 648
effective length of database: 8,340,069
effective search space: 5404364712
effective search space used: 5404364712
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)