Citrus Sinensis ID: 004458


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750--
MKTPVSDGDGSVSKRTLRKKVGLRNYDENLMDELIEGHLGGSFKKRNRTREALEKETETEAMIAFSLGFPIDALLEEEIRAGVVGVLGGKEQNDYIVVRNHILARWRGNVRVWLTKGQIKETVSSEYEHLMNSAYDFLLYNGYINFGVAPSFTANMPEEANEGSVIIVGAGLAGLAAAKQLMSFGFKVVVLEGRSRPGGRVYTQKMGKKGEFAAVDLGGSVITGIHANPLGVLARQLSIPLHKVRDNCPLYKPDGAPVNKEIDSKVEFIFNKLLDKVMELRKIKGGFANDVSLGSVLETLRQLYAVARSTEERELLDWHLANLEYANAGCLSDLSATYWDQDDPYEMGGDHCFLAGGNWRLIKALCEGVPIFYEKTVNTIKYGNEGVEVIAGDQMFQADMVLCTVPLGVLKEKTIKFEPELPQRKVAAIDRLGFGLLNKVAMVFPYVFWGEELDTFGCLNEQSSKRGEFFLFYGYHTVSGGPVLNALVAGEAAKTFESMDPSFLLHRVLNVLRGIYNPKGIDVPDPLQTICTRWGSDPFTHGSYSHVRVRSSGSDYDILAESVGSRLFFAGEATTRQYPATMHGAYLSGLREASRILRATRVQKYNSRRSLLRNVGSSNDILLDLFRRPDMEFGKFLFVFNPLTEDPKSLGLLRVMFENCEDDLRKASANSCQNPLNLPLYTLISREQANELQQVIGGNESKLSYLTKNLGLKLMGSSALGTVGSSLIANIANARRGRGRNRIAAGQRQITM
ccccccccccccccccccccccccccccccHHHHHHcccccccccccccHHHHccccHHHHHHHHHcccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccccccccccccCEEEEcccHHHHHHHHHHHHccccEEEECcccccccccCEccccccccccEEcccccECccccccHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEccccHHHHHHHHHccccccccccEEEEEEcccEEEEEEccEEEEccEEEEEcccHHHccccccccccccHHHHHHHHHcccccEEEEEEEccccccccccccCEEEcccccccccEEEEEEECccccccEEEEEEccHHHHHHHcccHHHHHHHHHHHHHHHccccccccccccEEEEccccccccccccccccccccccHHHHHHHccccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEcccccccccccEEEEEEEcccHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccEEECcccccccHHHHHHHHHHHHccccccccccccccccc
********************************ELI*************************AMIAFSLGFPIDALLEEEIRAGVVGVLGGKEQNDYIVVRNHILARWRGNVRVWLTKGQIKETVSSEYEHLMNSAYDFLLYNGYINFGVAPSFTANMPEEANEGSVIIVGAGLAGLAAAKQLMSFGFKVVVLEGRSRPGGRVYTQKMGKKGEFAAVDLGGSVITGIHANPLGVLARQLSIPLHKVRDNCPLYKPDGAPVNKEIDSKVEFIFNKLLDKVMELRKIKGGFANDVSLGSVLETLRQLYAVARSTEERELLDWHLANLEYANAGCLSDLSATYWDQDDPYEMGGDHCFLAGGNWRLIKALCEGVPIFYEKTVNTIKYGNEGVEVIAGDQMFQADMVLCTVPLGVLKEKTIKFEPELPQRKVAAIDRLGFGLLNKVAMVFPYVFWGEELDTFGCLNEQSSKRGEFFLFYGYHTVSGGPVLNALVAGEAAKTFESMDPSFLLHRVLNVLRGIYNPKGIDVPDPLQTICTRWGSDPFTHGSYSHVRVRSSGSDYDILAESVGSRLFFAGEATTRQYPATMHGAYLSGLREASRILRATRVQKYNSRRSLLRNVGSSNDILLDLFRRPDMEFGKFLFVFNPLTEDPKSLGLLRVMFENC*************NPLNLPLYTLISREQANELQQVIGGNESKLSYLTKNLGLKLMGSSALGTVGSSLIANIA********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTPVSDGDGSVSKRTLRKKVGLRNYDENLMDELIEGHLGGSFKKRNRTREALEKETETEAMIAFSLGFPIDALLEEEIRAGVVGVLGGKEQNDYIVVRNHILARWRGNVRVWLTKGQIKETVSSEYEHLMNSAYDFLLYNGYINFGVAPSFTANMPEEANEGSVIIVGAGLAGLAAAKQLMSFGFKVVVLEGRSRPGGRVYTQKMGKKGEFAAVDLGGSVITGIHANPLGVLARQLSIPLHKVRDNCPLYKPDGAPVNKEIDSKVEFIFNKLLDKVMELRKIKGGFANDVSLGSVLETLRQLYAVARSTEERELLDWHLANLEYANAGCLSDLSATYWDQDDPYEMGGDHCFLAGGNWRLIKALCEGVPIFYEKTVNTIKYGNEGVEVIAGDQMFQADMVLCTVPLGVLKEKTIKFEPELPQRKVAAIDRLGFGLLNKVAMVFPYVFWGEELDTFGCLNEQSSKRGEFFLFYGYHTVSGGPVLNALVAGEAAKTFESMDPSFLLHRVLNVLRGIYNPKGIDVPDPLQTICTRWGSDPFTHGSYSHVRVRSSGSDYDILAESVGSRLFFAGEATTRQYPATMHGAYLSGLREASRILRATRVQKYNSRRSLLRNVGSSNDILLDLFRRPDMEFGKFLFVFNPLTEDPKSLGLLRVMFENCEDDLRKASANSCQNPLNLPLYTLISREQANELQQVIGGNESKLSYLTKNLGLKLMGSSALGTVGSSLIANIANARRGRGRNRIAAGQRQITM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lysine-specific histone demethylase 1 homolog 2 Probable histone demethylase that reduces the levels of histone H3 'Lys-4' methylation in chromatin of the floral repressor FLOWERING LOCUS C (FLC) and the sporophytically silenced floral repressor FWA. Seems to act in partial redundancy with FLOWERING LOCUS D (FLD) to repress FLC expression. Required for cytosine methylation of FWA.confidentQ9LID0
Lysine-specific histone demethylase 1 homolog 2 Probable histone demethylase.probableQ6YYZ1
Lysine-specific histone demethylase 1 homolog 3 Probable histone demethylase.probableQ01H90

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XAG, chain A
Confidence level:very confident
Coverage over the Query: 60-603
View the alignment between query and template
View the model in PyMOL
Template: 1F8R, chain A
Confidence level:probable
Coverage over the Query: 160-244,259-606
View the alignment between query and template
View the model in PyMOL