BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 004472
(751 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1V33|A Chain A, Crystal Structure Of Dna Primase From Pyrococcus
Horikoshii
pdb|1V34|A Chain A, Crystal Structure Of Pyrococcus Horikoshii Dna Primase-utp
Complex
Length = 366
Score = 29.6 bits (65), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)
Query: 232 DAHVSTSGLGDRILKMKEERLKKNSEGAPEILSWVNRSRKIEQIKNVEKKKALQLSK 288
D H+ SG G I + E LK +S+ ILS+V+ S +I++VE+ + L L+K
Sbjct: 160 DIHIIYSGRGYHIRVLDEWALKLDSKSRERILSFVSAS----EIEDVEEFRKLLLNK 212
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.308 0.129 0.352
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 15,588,883
Number of Sequences: 62578
Number of extensions: 560179
Number of successful extensions: 1056
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1056
Number of HSP's gapped (non-prelim): 4
length of query: 751
length of database: 14,973,337
effective HSP length: 106
effective length of query: 645
effective length of database: 8,340,069
effective search space: 5379344505
effective search space used: 5379344505
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 55 (25.8 bits)