BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 004499
         (748 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3IYG|Q Chain Q, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM
           Cryo-Em Map
          Length = 512

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 432 PENTVDGETVGMPELTSSSHLM-FDSGSENLLDAVVASVCNSGSDV 476
           P + +  ET G   + S+  LM F  G ENL+DA V ++ ++G++V
Sbjct: 229 PFDGMITETKGTVLIKSAEELMNFSKGEENLMDAQVKAIADTGANV 274


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.130    0.381 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,812,452
Number of Sequences: 62578
Number of extensions: 899829
Number of successful extensions: 1328
Number of sequences better than 100.0: 18
Number of HSP's better than 100.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 1320
Number of HSP's gapped (non-prelim): 18
length of query: 748
length of database: 14,973,337
effective HSP length: 106
effective length of query: 642
effective length of database: 8,340,069
effective search space: 5354324298
effective search space used: 5354324298
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 55 (25.8 bits)