BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 004517
(747 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3SC7|X Chain X, First Crystal Structure Of An Endo-Inulinase, From
Aspergillus Ficuum: Structural Analysis And Comparison
With Other Gh32 Enzymes.
pdb|3RWK|X Chain X, First Crystal Structure Of An Endo-Inulinase, From
Aspergillus Ficuum: Structural Analysis And Comparison
With Other Gh32 Enzymes
Length = 516
Score = 37.4 bits (85), Expect = 0.030, Method: Compositional matrix adjust.
Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 1/55 (1%)
Query: 103 RSQPSSLEQGSITTGYATSTDL-PCAHNSDSVSLDKALNASAVSQSYDPNDSSGL 156
+ P++ G+I G+ATSTDL AH +++ + + A + YDPN++SGL
Sbjct: 59 QHNPTANVWGNICWGHATSTDLMHWAHKPTAIADENGVEAFTGTAYYDPNNTSGL 113
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.311 0.127 0.350
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,954,872
Number of Sequences: 62578
Number of extensions: 668563
Number of successful extensions: 1780
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 1778
Number of HSP's gapped (non-prelim): 10
length of query: 747
length of database: 14,973,337
effective HSP length: 106
effective length of query: 641
effective length of database: 8,340,069
effective search space: 5345984229
effective search space used: 5345984229
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 55 (25.8 bits)