Citrus Sinensis ID: 004539


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740------
MEKPVSSTSLARTKSDQLVETLSAAFKSPVSSETAGASDGGGTLSRKSSRRMLTAASPGRAGASGRNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIADSKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTANGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQGLGLAIGAILMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYADISPIVNGMRTDSGFREVCALVAMVFGYRLLAYLSLRKMKLHFGA
ccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEccccccccccccccccEEEccccEEEEEccccccHHHHHHHHHcccccccEEEEEEEcccccccccccEEEEEECcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHcccEEEEccccEEEEcccccHHHHHHHcccccccccccHHHHHHHccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHcccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
************************************************************************************************************************************************TLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVS*************************AIVHEYLVEAYETRVA*************************RNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQGLGLAIGAILMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYADISPIVNGMRTDSGFREVCALVAMVFGYRLLAYLSLRKMKLHF**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKPVSSTSLARTKSDQLVETLSAAFKSPVSSETAGASDGGGTLSRKSSRRMLTAASPGRAGASGRNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIADSKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQTENSENDTANGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQGLGLAIGAILMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYADISPIVNGMRTDSGFREVCALVAMVFGYRLLAYLSLRKMKLHFGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter G family member 22 confidentQ93YS4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QF4, chain A
Confidence level:confident
Coverage over the Query: 129-385
View the alignment between query and template
View the model in PyMOL
Template: 3BK7, chain A
Confidence level:confident
Coverage over the Query: 108-349
View the alignment between query and template
View the model in PyMOL
Template: 3GD7, chain A
Confidence level:probable
Coverage over the Query: 172-457
View the alignment between query and template
View the model in PyMOL