Citrus Sinensis ID: 004544


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-----
MAMVIQQQQQQQRESSSGSINKHQLDNGKYVRYTAEQVEALERVYSECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVNRKLTAMNKLLMEENDRLQKQVSQLVCENGYMKQQLRTAPATTDASCDSVVTTPQHSLRDANNPAGLLSIAEETLAEFLSKATGTAVDWVQMPGMKPGPDSVGIFAISQSCSGVAARACGLVSLEPTKIAEILKDRPSWFRDCRSLEVFTMFPAGNAGTIELLYTQAYAPTTLAPARDFWTLRYTTTLDNGSLVVCERSLSGSGAGPNPASAAQFVRAEMLPSGCLIRPCDGGGSIIHIVDHLNLEAWSVPEVLRPLYESSKVVAQRMTIAETSGEVVYGLGRQPAVLRTFSQRLSRGFNDAVNGFNDDGWSLMTCDGAEDVIIAVNSTKSLSTASNPTNSLAFLGGILCAKASMLLQNVPPALLVRFLREHRSEWADFNVDAYSAASLKAGSYAYPGMRPTRFTGSQIIMPLGHTIEHEELLEVIRLEGHSLAQEDAFVSRDIHLLQICSGVDENAVGACSELVFAPIDEMFPDDGPLLPSGFRIIPLDSKTPDTPDTLTAHRTLDLTSSLEVGPATNPAAGDSSSCHHTRSVLTIAFQFPFESNLQDNVATMARQYVRSVISSVQRVAMAICPSGLSPTLGPKLSPGSPEALTLAHWICQSYSYHLGAELLRSDSVGGDSVLKNLWQHSDAILCCSLKVPLQFHQR
ccccccHHHHHcccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccEEEECcccccccHHHHHHHHHccccccccccEEEEEEEEEEcccccEEEEEEEccccccccccccccccccEECcccccEEEEcccccEEEEEEEEccccccccccHHHHHHHcHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEECccccccccccccccccccEEEEEEccccccccHHHHHHHHHHcccHHHHccccccccccccccccccccccccccccccEEEEcccccccccEEEEEEEccccccccccccHHHHHHHHHHccccccccccccEEEEccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccEEEEEccccccccccc
****************************KYVRYTAEQVEALERVYSECPK*****RQQLIRECPILSNIEPKQIKVWFQNRR**************VNRKLTAMNKLLMEENDRLQK***QLVCENGYM**************C*SV*******LRDANNPAGLLSIAEETLAEFLSKATGTAVDWVQMPGMKPGPDSVGIFAISQSCSGVAARACGLVSLEPTKIAEILKDRPSWFRDCRSLEVFTMFPAGNAGTIELLYTQAYAPTTLAPARDFWTLRYTTTLDNGSLVVCERSLSGSGA********QFVRAEMLPSGCLIRPCDGGGSIIHIVDHLNLEAWSVPEVLRPLYESSKVVAQRMTIAETSGEVVYGLGRQPAVLRTFSQRLSRGFNDAVNGFNDDGWSLMTCDGAEDVIIAVNSTKS*******TNSLAFLGGILCAKASMLLQNVPPALLVRFLREHRSEWADFNVDAYSAASLKAGSYAYPGMRPTRFTGSQIIMPLGHTIEHEELLEVIRLEGHSLAQEDAFVSRDIHLLQICSGVDENAVGACSELVFAPIDEMFPDDGPLLPSGFRIIP*****************************************HTRSVLTIAFQFPFESNLQDNVATMARQYVRSVISSVQRVAMAICPS****************ALTLAHWICQSYSYHLGAELLRSDSVGGDSVLKNLWQHSDAILCCSLKVPLQFH**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMVIQQQQQQQRESSSGSINKHQLDNGKYVRYTAEQVEALERVYSECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEASRLQTVxxxxxxxxxxxxxxxxxxxxxxxxxxxxNGYMKQQLRTAPATTDASCDSVVTTPQHSLRDANNPAGLLSIAEETLAEFLSKATGTAVDWVQMPGMKPGPDSVGIFAISQSCSGVAARACGLVSLEPTKIAEILKDRPSWFRDCRSLEVFTMFPAGNAGTIELLYTQAYAPTTLAPARDFWTLRYTTTLDNGSLVVCERSLSGSGAGPNPASAAQFVRAEMLPSGCLIRPCDGGGSIIHIVDHLNLEAWSVPEVLRPLYESSKVVAQRMTIAETSGEVVYGLGRQPAVLRTFSQRLSRGFNDAVNGFNDDGWSLMTCDGAEDVIIAVNSTKSLSTASNPTNSLAFLGGILCAKASMLLQNVPPALLVRFLREHRSEWADFNVDAYSAASLKAGSYAYPGMRPTRFTGSQIIMPLGHTIEHEELLEVIRLEGHSLAQEDAFVSRDIHLLQICSGVDENAVGACSELVFAPIDEMFPDDGPLLPSGFRIIPLDSKTPDTPDTLTAHRTLDLTSSLEVGPATNPAAGDSSSCHHTRSVLTIAFQFPFESNLQDNVATMARQYVRSVISSVQRVAMAICPSGLSPTLGPKLSPGSPEALTLAHWICQSYSYHLGAELLRSDSVGGDSVLKNLWQHSDAILCCSLKVPLQFHQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox-leucine zipper protein HOX9 Probable transcription factor.confidentQ9AV49
Homeobox-leucine zipper protein REVOLUTA Probable transcription factor involved in the regulation of interfascicular fiber (cortical cells) and secondary xylem differentiation in the inflorescence stems. Required for lateral shoot meristems (LSMs) and flower meristems (FMs) initiation. May be involved in the determination of vascular patterning and organ polarity.confidentQ9SE43
Homeobox-leucine zipper protein HOX10 Probable transcription factor.probableA2XBL9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PSO, chain A
Confidence level:probable
Coverage over the Query: 166-365
View the alignment between query and template
View the model in PyMOL
Template: 1AU7, chain A
Confidence level:probable
Coverage over the Query: 7-15,32-89
View the alignment between query and template
View the model in PyMOL
Template: 1CI6, chain A
Confidence level:probable
Coverage over the Query: 79-134
View the alignment between query and template
View the model in PyMOL