BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 004618
(741 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2A9V|A Chain A, Crystal Structure Of A Putative Gmp Synthase Subunit A
Protein (Ta0944m) From Thermoplasma Acidophilum At 2.45
A Resolution
pdb|2A9V|B Chain B, Crystal Structure Of A Putative Gmp Synthase Subunit A
Protein (Ta0944m) From Thermoplasma Acidophilum At 2.45
A Resolution
pdb|2A9V|C Chain C, Crystal Structure Of A Putative Gmp Synthase Subunit A
Protein (Ta0944m) From Thermoplasma Acidophilum At 2.45
A Resolution
pdb|2A9V|D Chain D, Crystal Structure Of A Putative Gmp Synthase Subunit A
Protein (Ta0944m) From Thermoplasma Acidophilum At 2.45
A Resolution
Length = 212
Score = 30.0 bits (66), Expect = 4.7, Method: Composition-based stats.
Identities = 16/62 (25%), Positives = 32/62 (51%)
Query: 296 EVHGNPNLFTNPAASATTENESNVPKSTHQSFPTFHPPFTQFRHDQDDYRSFLHISSAFS 355
E+ P+ FT A+SAT + + K+ FHP ++ +D +R+F+ I +++
Sbjct: 144 EIINLPDDFTLAASSATCQVQGFYHKTRPIYATQFHPEVEHTQYGRDIFRNFIGICASYR 203
Query: 356 SL 357
+
Sbjct: 204 EI 205
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.128 0.373
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,553,179
Number of Sequences: 62578
Number of extensions: 730242
Number of successful extensions: 1078
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1074
Number of HSP's gapped (non-prelim): 4
length of query: 741
length of database: 14,973,337
effective HSP length: 106
effective length of query: 635
effective length of database: 8,340,069
effective search space: 5295943815
effective search space used: 5295943815
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 55 (25.8 bits)