Citrus Sinensis ID: 004668


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------74
MLIFALVHMFVLNGTLGFPLWLHFIPGIQFRTDNEPFKAEMQRFTAKIVDMMKQEKLYASQGGPIILSQIENEYGNIDSAYGAAGKSYIKWAAGMALSLDTGVPWVMCQQSDAPDPIINTCNGFYCDQFTPNSNNKPKMWTENWSGWFLSFGGAVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPFISTSYDYDAPLDEYGLIRQPKWGHLKDLHKAIKLCEAALVATDPTYPSLGPNLEATVYKTGSGLCSAFLANIGTNSDVTVKFNGNSYLLPAWSVSILPDCKNVVFNTAKINSVTLVPSFSRQSLQVAADSSDAIGSGWSYINEPVGISKDDAFTKPGLLEQINTTADQSDYLWYSLSTNIKADEPLLEDGSKTVLHVQSLGHALHAFINGKLVGSGYGSSSNAKVTVDFPIALAPGKNTFDLLSLTVGLQNYGAFYEKTGAGITGPVQLKGSGNGTNIDLSSQQWTYQTGLKGEELNFPSGSSTQWDSKSTLPKLQPLVWYKTTFDAPAGSEPVAIDFTGMGKGEAWVNGQSIGRYWPTYVSQNGGCTDSCNYRGAYSSNKCLKNCGKPSQSLYHVPRSWLKSSGNTLVLFEEIGGDPTKISFVTKQLGSSLCSHVTDSHPLPVDMWGSDSKIQRKPGPVLSLECPNPNQVISSIKFASFGTPLGTCGSFSRGRCSSARSLSVVRQACVGSKSCSIGVSVNTFGDPCKGVMKSLAVEASCT
cEEEEEEHHHHcccccccccccccccccEEccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccHHHHHHHHHHHHHHHHcHHccccccccEEcccccccccccccccccccccccccccccccEEECcccccccccccccccccHHHHHHHHHHHHHcccCEEEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccEEEEcccccccccccccccccccEEEEEccCEEEEEEEEEEEcccccCEEEEccEEEEEECcccccccccccccccccccccccEEECcccccccccccccccccccccccccccccEEEEEEEEECccccccccccccEEEEEEEccEEEEEEccCEEEEECccccccEEEEEEEEEccccccEEEEEEEEccccccccccccccccCCccEEEEEcccccEEccccccCEEEccccccccccccccccccccccccccccccEEEEEEECcccccccEEEECcccccCEEEEccccCEEECccccccccccccccccccccccccccccccccCEEEEccccccccccccEEEEEEEcccccccEEEEEEEEcccccEEcccccccccccccccccccccccccEEEEcccccCEEEEEEEEECccccccccccccccccccHHHHHHHHHcccccccEEEEcccccccccccccccEEEEEEEc
MLIFALVHMFVLNGTLGFPLWLHFIPGIQFRTDNEPFKAEMQRFTAKIVDMMKQEKLYASQGGPIILSQIENEYGNIDSAYGAAGKSYIKWAAGMALSLDTGVPWVMCQQSDAPDPIINTCNGFYCDQFTPNSNNKPKMWTENWSGWFLSFGGAVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPFISTSYDYDAPLDEYGLIRQPKWGHLKDLHKAIKLCEAALVATDPTYPSLGPNLEATVYKTGSGLCSAFLANIGTNSDVTVKFNGNSYLLPAWSVSILPDCKNVVFNTAKINSVTLVPSFSRQ*********DAIGSGWSYINEPVGISKDDAFTKPGLLEQINTTADQSDYLWYSLSTNIKADEPLLEDGSKTVLHVQSLGHALHAFINGKLVGSGYGSSSNAKVTVDFPIALAPGKNTFDLLSLTVGLQNYGAFYEKTGAGITGPVQLKGSGNGTNIDLSSQQWTYQTGLKGEELNF**************PKLQPLVWYKTTFDAPAGSEPVAIDFTGMGKGEAWVNGQSIGRYWPTYVSQNGGCTDSCNYRGAYSSNKCLKNCGKPSQSLYHVPRSWLKSSGNTLVLFEEIGGDPTKISFVTKQLGSSLCSHVTDSHPLPVDMW*************LSLECPNPNQVISSIKFASFGTPLGTCGSFSRGRCSSARSLSVVRQACVGSKSCSIGVSVNTFGDPCKGVMKSLAVEASCT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIFALVHMFVLNGTLGFPLWLHFIPGIQFRTDNEPFKAEMQRFTAKIVDMMKQEKLYASQGGPIILSQIENEYGNIDSAYGAAGKSYIKWAAGMALSLDTGVPWVMCQQSDAPDPIINTCNGFYCDQFTPNSNNKPKMWTENWSGWFLSFGGAVPYRPVEDLAFAVARFFQRGGTFQNYYMYHGGTNFDRTSGGPFISTSYDYDAPLDEYGLIRQPKWGHLKDLHKAIKLCEAALVATDPTYPSLGPNLEATVYKTGSGLCSAFLANIGTNSDVTVKFNGNSYLLPAWSVSILPDCKNVVFNTAKINSVTLVPSFSRQSLQVAADSSDAIGSGWSYINEPVGISKDDAFTKPGLLEQINTTADQSDYLWYSLSTNIKADEPLLEDGSKTVLHVQSLGHALHAFINGKLVGSGYGSSSNAKVTVDFPIALAPGKNTFDLLSLTVGLQNYGAFYEKTGAGITGPVQLKGSGNGTNIDLSSQQWTYQTGLKGEELNFPSGSSTQWDSKSTLPKLQPLVWYKTTFDAPAGSEPVAIDFTGMGKGEAWVNGQSIGRYWPTYVSQNGGCTDSCNYRGAYSSNKCLKNCGKPSQSLYHVPRSWLKSSGNTLVLFEEIGGDPTKISFVTKQLGSSLCSHVTDSHPLPVDMWGSDSKIQRKPGPVLSLECPNPNQVISSIKFASFGTPLGTCGSFSRGRCSSARSLSVVRQACVGSKSCSIGVSVNTFGDPCKGVMKSLAVEASCT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-galactosidase 8 confidentQ9SCV4
Beta-galactosidase probableP45582
Beta-galactosidase Involved in cell wall degradation. Degrades polysaccharides containing beta-(1-->4)-linked galactans, acting as an exo-(1-->4)-beta-D-galactanase.probableP48980

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.1.-Glycosidases, i.e. enzymes hydrolyzing O- and S-glycosyl compounds.probable
3.2.1.23Beta-galactosidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D3A, chain A
Confidence level:very confident
Coverage over the Query: 17-445,462-488
View the alignment between query and template
View the model in PyMOL
Template: 3OG2, chain A
Confidence level:confident
Coverage over the Query: 17-619
View the alignment between query and template
View the model in PyMOL
Template: 3D3A, chain A
Confidence level:confident
Coverage over the Query: 17-445,462-488
View the alignment between query and template
View the model in PyMOL
Template: 2JX9, chain A
Confidence level:probable
Coverage over the Query: 655-737
View the alignment between query and template
View the model in PyMOL