Citrus Sinensis ID: 004702


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-----
MGCRCSTSRTSTAAAAHAQAKPRCPNRCGDVEIPYPFGTKRGCFLNKDFLITCNDTLNPPKPFLRKSSIEVVNISIDGHLNVMQYTAKVCYDAKGYSVDSNLPYITLSKFTFSRTGNKFVVIGCDSYAYVLGFLGEDRYKSGCTSTCDSLDYVTNGSCVGTGCCQIEIPGGLKELEVEAFSFKNHTKVSSFNPCTYAFVVDQSQFHFTSNYLALGGIRDEFPMVLDWEIITDKTCEEAKICGLNASCDTPKDNTSTSSGYRCKCNKGYEGNPYLSDGCRDVNECEDPSRNNCTHICDNIPGSYTCRCRKGFHGDGRKDGGGCTPNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILRQELSKLHGQSSEKAKIFTEEEIKTVTNNYADVIGCGGSGNVYKGFLPDRTPVAVKKSKFVDQAKIDEFINELVVVLQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEHIHKKGNLSWERRLRITAETAGVLSYLHSETNVPIIHRDVKSANILLDENCTPKVSDFGASKLVPIDAIQNCTVVQGTLGYLDPEYLQTCKLTDKSDVYSFGVVLVELLTGKMALLSDKPEEERSLAMNFLSSLKQNRLLEILDNRIVNDGNKQQLKEVAKLAARCISVRGEERPTMKEVSLELQGRLSLMSNGQYYLRDNVESNGVQETEYFTSTFYECRNGIGSHTTPTDGYDSVQQLELMAFDYER
cccccccHHHHccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccEEEEEEEEccEEEEEEEcccccccccccccccccccccccccEEEccccEEEEEccccEEEEccccccccccccEEccccccccccccccccccccEECcccccccEEEEEEEcccccccccccccEEEEEEEcccEEECccccccccccccccEEEEEEEcccccHHHHHccccccEEccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccEEEEcHHHHHHHHcccccccccccccEEEEEEcccccEEEEEEcccccHHHHHHHHHHHHHHHHccccccccEEcEEcccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEECcccccccHHHHcccccccccccccccEEEEEHHccccccccccccccccHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccc
*************************NRCGDVEIPYPFGTKRGCFLNKDFLITCNDTLNPPKPFLRKSSIEVVNISIDGHLNVMQYTAKVCYDAKGYSVDSNLPYITLSKFTFSRTGNKFVVIGCDSYAYVLGFLGEDRYKSGCTSTCDSLDYVTNGSCVGTGCCQIEIPGGLKELEVEAFSFKNHTKVSSFNPCTYAFVVDQSQFHFTSNYLALGGIRDEFPMVLDWEIITDKTCEEAKICGLNASCDTPKDNTSTSSGYRCKCNKGYEGNPYLSDGCRDVNECEDPSRNNCTHICDNIPGSYTCRCRKGFHGDGRKDGGGCTPNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNG**I****************KIFTEEEIKTVTNNYADVIGCGGSGNVYKGFLPDRTPVAVKKSKFVDQAKIDEFINELVVVLQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEHIHKKGNLSWERRLRITAETAGVLSYLHSETNVPIIHRDVKSANILLDENCTPKVSDFGASKLVPIDAIQNCTVVQGTLGYLDPEYLQTCKLTDKSDVYSFGVVLVELLTGKMALL****EEERSLAMNFLSSLKQNRLLEILDNRIVNDGNKQQLKEVAKLAARCISVRGEERPTMKEVSLELQGRLSLM*****************************************GY********M****E*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCRCSTSRTSTAAAAHAQAKPRCPNRCGDVEIPYPFGTKRGCFLNKDFLITCNDTLNPPKPFLRKSSIEVVNISIDGHLNVMQYTAKVCYDAKGYSVDSNLPYITLSKFTFSRTGNKFVVIGCDSYAYVLGFLGEDRYKSGCTSTCDSLDYVTNGSCVGTGCCQIEIPGGLKELEVEAFSFKNHTKVSSFNPCTYAFVVDQSQFHFTSNYLALGGIRDEFPMVLDWEIITDKTCEEAKICGLNASCDTPKDNTSTSSGYRCKCNKGYEGNPYLSDGCRDVNECEDPSRNNCTHICDNIPGSYTCRCRKGFHGDGRKDGGGCTPNQYTVIKVALGVGISFVVAIMSISWLHFLWTRRRHMKLKEKFFEQNGGSILRQELSKLHGQSSEKAKIFTEEEIKTVTNNYADVIGCGGSGNVYKGFLPDRTPVAVKKSKFVDQAKIDEFINELVVVLQINRRNVVRLLGCCLETQVPLLVYEFVGNGTLFEHIHKKGNLSWERRLRITAETAGVLSYLHSETNVPIIHRDVKSANILLDENCTPKVSDFGASKLVPIDAIQNCTVVQGTLGYLDPEYLQTCKLTDKSDVYSFGVVLVELLTGKMALLSDKPEEERSLAMNFLSSLKQNRLLEILDNRIVNDGNKQQLKEVAKLAARCISVRGEERPTMKEVSLELQGRLSLMSNGQYYLRDNVESNGVQETEYFTSTFYECRNGIGSHTTPTDGYDSVQQLELMAFDYER

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Wall-associated receptor kinase 2 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. Binding to pectin may have significance in the control of cell expansion, morphogenesis and development.probableQ9LMP1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VHE, chain A
Confidence level:very confident
Coverage over the Query: 494-677
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 389-672
View the alignment between query and template
View the model in PyMOL
Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 237-312
View the alignment between query and template
View the model in PyMOL
Template: 2QNJ, chain A
Confidence level:probable
Coverage over the Query: 434-703
View the alignment between query and template
View the model in PyMOL
Template: 2JDO, chain A
Confidence level:probable
Coverage over the Query: 451-627,643-714
View the alignment between query and template
View the model in PyMOL