Citrus Sinensis ID: 004706


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730----
MGVPAFYRWLADRYPLSIVDVVEEDPQVDGEGVARPVDVSKPNPNGMEFDNLYLDMNGIIHPCFHPDGKPAPTSYDDVFKSIFDYIDHIFLLVRPRKLLYLAIDGVAPRAKMNQQRTRRFRAAKDAAEAEAEEERLRKEFEEAGKLLSAKEKPETCDSNVITPGTQFMAVLSAALQYFIQARLNQIPGWQFTKVILSDANVPGEGEHKIMSYIRLQRNLPGFDPNTRHCLYGLDADLIMLSLATHEIHFSILREVITLPGQQEKCFVCGQVGHLAAECHGKPGDNPADWNGVDDTPIHKKKYQFLNIWVLREYLQYELDIPNPPFPINFERIVDDFVFLCFFVGNDFLPHMPTLEIREGAINLLMHVYRREFTAMGGYLTDAGEVLLDRVEKFIQSVAVYEDQIFQKRTRIQQAYEYNEAMKLNARRESSEELLQAPVAVADTVKLGEPGYKERYYADKFEISNPEEIDKVKKDVVLKYVEGLCWVCRYYYQDVCSWQWFYPYHYAPFASDLKDLSDLEITFFLGEPFRPFDQLMGTLPAASSSALPEKYRNLMTDPSSPIYKFYPPDFQIDMNGKRFAWQGVVKLPFIDEKLLLRQTKKLEVFLTEEELFRNSVMLDLLYVHPQHPLYQQITLYCQLYHQLPPQDRFAWEIDVNASGGMNGYIWLCERNGLRSIIPSPVKGLPDIERNQAINVTYLNPQKHRHIPEPPKGATIPAKTIVGASKAGRGHKCLEP
ccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEECcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEECccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccccHHHHHHHHHHHHccccccccccEEEEEccHHHHHHHHHccccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccCEEEcccHHHHHHHHHHHHHHHcccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccCEccccccccccccccccccccccccccccccHHHHHHHcccccccccccHHHHHHcccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHccccHHHHHHccccccEEEEcccccccHHHHHHHcccccccccccccCECccccccccccEEEcccccccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccc
MGVPAFYRWLADRYPLSIVDVVEEDPQVDGEGVARPVDVSKPNPNGMEFDNLYLDMNGIIHPCFHPDGKPAPTSYDDVFKSIFDYIDHIFLLVRPRKLLYLAIDGVAPRAKM*******************************************CDSNVITPGTQFMAVLSAALQYFIQARLNQIPGWQFTKVILSDANVPGEGEHKIMSYIRLQRNLPGFDPNTRHCLYGLDADLIMLSLATHEIHFSILREVITLPGQQEKCFVCGQVGHL*AECH**************DTPIHKKKYQFLNIWVLREYLQYELDIPNPPFPINFERIVDDFVFLCFFVGNDFLPHMPTLEIREGAINLLMHVYRREFTAMGGYLTDAGEVLLDRVEKFIQSVAVYEDQIFQKRTRIQQAYEYNEAMKLNARRESSEELLQAPVAVADTVKLGEPGYKERYYADKFEISNPEEIDKVKKDVVLKYVEGLCWVCRYYYQDVCSWQWFYPYHYAPFASDLKDLSDLEITFFLGEPFRPFDQLMGTLPAASSSALPEKYRNLMTDPSSPIYKFYPPDFQIDMNGKRFAWQGVVKLPFIDEKLLLRQTKKLEVFLTEEELFRNSVMLDLLYVHPQHPLYQQITLYCQLYHQLPPQDRFAWEIDVNASGGMNGYIWLCERNGLRSIIPSPVKGLPDIERNQAINVTYLNPQKHRHIPEPPKGATIPAKTI*********H*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVPAFYRWLADRYPLSIVDVVEEDPQVDGEGVARPVDVSKPNPNGMEFDNLYLDMNGIIHPCFHPDGKPAPTSYDDVFKSIFDYIDHIFLLVRPRKLLYLAIDGVAPRAKMNQQRTRxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSAKEKPETCDSNVITPGTQFMAVLSAALQYFIQARLNQIPGWQFTKVILSDANVPGEGEHKIMSYIRLQRNLPGFDPNTRHCLYGLDADLIMLSLATHEIHFSILREVITLPGQQEKCFVCGQVGHLAAECHGKPGDNPADWNGVDDTPIHKKKYQFLNIWVLREYLQYELDIPNPPFPINFERIVDDFVFLCFFVGNDFLPHMPTLEIREGAINLLMHVYRREFTAMGGYLTDAGEVLLDRVEKFIQSVAVYEDQIFQKRTRIQQAYEYNEAMKLNARRESSEELLQAPVAVADTVKLGEPGYKERYYADKFEISNPEEIDKVKKDVVLKYVEGLCWVCRYYYQDVCSWQWFYPYHYAPFASDLKDLSDLEITFFLGEPFRPFDQLMGTLPAASSSALPEKYRNLMTDPSSPIYKFYPPDFQIDMNGKRFAWQGVVKLPFIDEKLLLRQTKKLEVFLTEEELFRNSVMLDLLYVHPQHPLYQQITLYCQLYHQLPPQDRFAWEIDVNASGGMNGYIWLCERNGLRSIIPSPVKGLPDIERNQAINVTYLNPQKHRHIPEPPKGATIPAKTIVGASKAGRGHKCLEP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
5'-3' exoribonuclease 4 Possesses 5'->3' exoribonuclease activity. Acts as an endogenous post-transcriptional gene silencing (PTGS) suppressor. Degrades miRNA target cleavage products that lack a 5'-cap structure. Antagonizes the negative feedback regulation on EIN3 by promoting EBF1 and EBF2 mRNA decay, which consequently allows the accumulation of EIN3 protein to trigger the ethylene response.probableQ9FQ04

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FQD, chain A
Confidence level:very confident
Coverage over the Query: 2-257,275-286,300-409
View the alignment between query and template
View the model in PyMOL