Citrus Sinensis ID: 004770

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-

MSSIEFLRSTIHNRFLYANSSYNLHGGSFCHSRCRVYYHNTYRFASHAILFPSVIISNSQQKLSLKRGLLYSNQNLREIKILASSKDGESSETSESDGQSQSQTQSPTSTDSPTSQRREKRNKSNGFWWSKGKKFKWQPIIQAQEIGVLLLQLGIVMFVMRLLRPGIPLPGSEPRTSTTFVSVPYSDFLSKINSNQVAKVEVDGVHIMFKLKNDGSIQESEVITNKFQESESLLKSVTPTKRIVYTTTRPSDIKTPYEKMLENQVEFGSPDKRSGGFLNSALIALFYVAVLAGLLHRFPVSFSQTAGQVGHRKTRGPGGAKVSEQGDTITFADVAGVDEAKEELEEIVEFLRSPDKYIRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGASRVRDLFARAKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATNRSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGFTGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARHEAGHAVVGTAVASLLPGQPRVEKLSILPRTGGALGFTYTPANEDRYLLFIDELCGRLVTLLGGRAAEEVAYSGRISTGALDDIRRATDMAYKAIAEYGLNRTIGPVSIATLSSGGIDESGGGVPWGRDQVLCFC

cccccccccccccccccccccccccccccccccccEECcccccccccccccccEEEcccccHHHHHcccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccEEEEEccEEEEEEccccccccHHHHHccccccHHHHccccccccEEEEECcccccccHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEcccccccHHHHHHHHHHHHHcccccHHHHccccccccEEEEcccccHHHHHHHHHHccccccEEEccccccEEccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHcHHHHHHHHHccccccccccccccccHHHHHcccccHHcccHHHccccccccEEEEEEcccccccEEEEcccccccccccHHHHHHHHHHHHccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccEEcccccccccccccccccccccccccc

****EFLRSTIHNRFLYANSSYNLHGGSFCHSRCRVYYHNTYRFASHAILFPSVIISNSQQKLSLKRGLLYSNQNLREIKI********************************************GFWWSKGKKFKWQPIIQAQEIGVLLLQLGIVMFVMRLLRPGIPLP*******TTFVSVPYSDFLSKINSNQVAKVEVDGVHIMFKLKNDGSI*****I*******ESLLKSVTPTKRIVYTTTRPSDIKTPYEKMLENQVEFGSPDKRSGGFLNSALIALFYVAVLAGLLHRFPVSFSQ*******************EQGDTITFADVAGVDEAKEELEEIVEFLRSPDKYIRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGASRVRDLFARAKKEAPSIIFIDEIDAVAKSRDGRF*IVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATNRSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGFTGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARHEAGHAVVGTAVASLLPGQPRVEKLSILPRTGGALGFTYTPANEDRYLLFIDELCGRLVTLLGGRAAEEVAYSGRISTGALDDIRRATDMAYKAIAEYGLNRTIGPVSIATLSSGGIDESGGGVPWGRDQVLCFC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-dependent zinc metalloprotease FTSH 9, chloroplastic	Probable ATP-dependent zinc metallopeptidase.	confident	Q9FIM2
ATP-dependent zinc metalloprotease FTSH 7, chloroplastic	Probable ATP-dependent zinc metallopeptidase.	probable	Q6H6R9
ATP-dependent zinc metalloprotease FtsH	Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins.	probable	A0LN68

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1LV7, chain A
Confidence level:very confident
Coverage over the Query: 324-579
View the alignment between query and template
View the model in PyMOL

Template: 2DHR, chain A
Confidence level:very confident
Coverage over the Query: 321-710
View the alignment between query and template
View the model in PyMOL

Template: 3CF2, chain A
Confidence level:very confident
Coverage over the Query: 243-436,452-526,543-558
View the alignment between query and template
View the model in PyMOL