Citrus Sinensis ID: 004808

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------73

MDSGFIFEPPSDEEIEELQSEYEEDQGEEVDVEKPSKRAKQSPWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDNDHSDSEFDQHEDYKPEDEDDFSNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAILQEEREERILRKAEMEATKAENMIAHKEEIFARPKRTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSAQQAEDLKIKEKRKREREKNLPRKERRKLEAAREMLEDEDQVDKLQGSGKDKKEKAGISMVDLAYRRAKAVKAKQKALDAGKIVKSNGKKSKHSSQESNSRAKEMRELFHSDMSEKKQKRTGGIGKKPKHSFKSKSRYKRR

ccccccccccccccHHcccccccccccccccccccccccccccccccccccccccHcccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHcccccEEEEcccccHHHHHcHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHccccccccccccEEEEEccccccccccHHHHHHHHHHcccccccccEEccccHHHHHHHHHHcccccEEEEccccccccccEEEEEEEcccccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccEEEEcccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcccccHHHHccccccccccccccccccccccc

**SGFIFEPP*************************************************************************************************************ASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSITKWSKIIEQMEDQVAAIL************************HKEEIFARPKRTWFVT************************************************************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDSGFIFEPPSDEEIEELQSEYEEDQGEEVDVEKPSKRAKQSPWDFAAYSESVSDEHFRRRTTSVDFKITKSLQQRSVPIVDNDHSDSEFDQHEDYKPEDEDDFSNAGDTKSFFAPADGASFHANSFMELNLSRPLLRACEALGYSKPTPIQAACIPLALTGRDICGSAITGSGKTAAFALPTLERLLYRPKRIPAIRVLILTPTRELAVQVHSMIEKIAQFTDIRCCLVVGGLSTKMQETALRSMPDIVVATPGRMIDHLRNSMSVDLDDLAVLILDEADRLLELGFSAEIHELVRLCPKRRQTMLFSATLTEDVDELIKLSLTKPLRLSADPSAKRPSTLTEEVVRIRRMREVNQEAVLLSLCSKTFTSKVIIFSGTKQAAHRLKILFGLAALKAAELHGNLTQAQRLEALELFRKQHVDFLIATDVAARGLDIIGVQTVINYACPRDLTSYVHRVGRTARAGREGYAVTFVTDNDRSLLKAIAKRAGSKLKSRIVAEQSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFARPKRTWFVTEKEKKLAVKADKASIEKGKGSGNEVTSxxxxxxxxxxxxxxxxxxxxxPRKERRKLEAAREMLEDEDQVDKLQGSGKDKKEKAGISMVDLAYRRAKAVKAKQKALDAGKIVKSNGKKSKHSSQESNSRAKEMRELFHSDMSEKKQKRTGGIGKKPKHSFKSKSRYKRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DEAD-box ATP-dependent RNA helicase 28		probable	Q0INC5
DEAD-box ATP-dependent RNA helicase 28		probable	Q9ZRZ8
Probable ATP-dependent RNA helicase ddx27	Probable ATP-dependent RNA helicase which may be involved in ribosome biogenesis.	probable	Q54TJ4

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.6.-.-	Acting on acid anhydrides.	probable
3.6.4.-	Acting on acid anhydrides; involved in cellular and subcellular movement.	probable
3.6.4.13	RNA helicase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BER, chain A
Confidence level:very confident
Coverage over the Query: 123-332
View the alignment between query and template
View the model in PyMOL

Template: 3EIQ, chain A
Confidence level:very confident
Coverage over the Query: 124-497
View the alignment between query and template
View the model in PyMOL

Template: 2D7D, chain A
Confidence level:confident
Coverage over the Query: 301-503,537-559
View the alignment between query and template
View the model in PyMOL