Citrus Sinensis ID: 004820

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------73

MHADVETDEVYAQMTLQPLSPEEQKDTFVPIELGIPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPSLDFSLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAIRPPTVMPSSVLSSDSMHIGLLAAAAHAAATNSCFTVFFNPRASPSEFVIPLTKYVKAVFHTRVSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWSNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRLKRPWHPSTSSFNDNRDETASGLNWLRGGTGEQGLTTLNFQSLGMFPWMQQRVEPSFLGNDHNQQYQAMLAAGMQSGDPVRQQFMQLQQPFQYLQQSGSQNPLQLKQQQHLLQQLNSQAEDRAQQQQQPQQHMYHDALQIRTDELLQRQQSNLPSPSFSKANFMDSSTEISVSISPMQNMLGSLPEGSGNLLNFSGAGPSMLRQQFPQQSLGSKYEPSQVRDFVHSMSLPSSYNGKDAAVGTENCNTDSQNSVVFGVHIDSSGLLLPTTVSSFTTSVDPGVSSMPLGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRGNCGRDPVGSLEY

cccccccccEEEEEEEECccccccccccccccccccccccccCEEEEccccccccccccccccccHHHHcccccccccccccEEEEEEcccccEEEEEEEccccccccccccccccccccccccccEEEEEEcccccEEEEEEEcccccccccccccccccccHHHHHHHHHHHcccccEEEEEccccccccEEEccHHHHHHHHccccccccEEEEEcccccccEEEEEcEEEECcccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccHHHHccccccccccccccccccHHHHHHHHHHHHcccccHHHHccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccEEcccccccHHHHHHHHHHHHccccccccccccccEEEEEEccccEEEcccccHHHHHHHccEEEEEcHHHHHcccccccccccccccccccccccccccccccccc

****VETDEVYAQMTLQPL***********I*****SKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPSLDFSLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAIRPPTVMPSSVLSSDSMHIGLLAAAAHAAATNSCFTVFFNPRASPSEFVIPLTKYVKAVFHTRVSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWSNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRLKRPW****************GLNWLR*******LTTL***SLGMFPWMQQRVEPSFLG*****************************************************************************************************************************************************************************************************************************************************************PTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILS***************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHADVETDEVYAQMTLQPLSPEEQKDTFVPIELGIPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPSLDFSLQPPAQELIARDLHDVEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRAIRPPTVMPSSVLSSDSMHIGLLAAAAHAAATNSCFTVFFNPRASPSEFVIPLTKYVKAVFHTRVSVGMRFRMLFETEESSVRRYMGTITGISDLDPVRWSNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSLFPLRLKRPWHPSTSSFNDNRDETASGLNWLRGGTGEQGLTTLNFQSLGMFPWMQQRVEPSFLGNDHNQQYQAMLAAGMQSGDPVRQQFMQLQQPFQYLQQSGSQNPLQxxxxxxxxxxxxxxxxxxxxxQQQPQQHMYHDALQIRTDELLQRQQSNLPSPSFSKANFMDSSTEISVSISPMQNMLGSLPEGSGNLLNFSGAGPSMLRQQFPQQSLGSKYEPSQVRDFVHSMSLPSSYNGKDAAVGTENCNTDSQNSVVFGVHIDSSGLLLPTTVSSFTTSVDPGVSSMPLGDSGFHNSMYGCMQDSSELLHNVGQIDQLTPTRTFVKVYKSGSVGRSLDISRFSSYNELREELGQMFGIEGKFEDPLRSGWQLVFVDRENDVLLLGDDPWEAFVSNVWYIKILSPEDVQKMGEQGVESFSPSSGQRANSRGNCGRDPVGSLEY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Auxin response factor 12	Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	probable	Q0J951
Auxin response factor 8	Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Seems to act as transcriptional activator. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Regulates both stamen and gynoecium maturation. Promotes jasmonic acid production. Partially redundant with ARF6. Involved in fruit initiation. Acts as an inhibitor to stop further carpel development in the absence of fertilization and the generation of signals required to initiate fruit and seed development.	probable	Q9FGV1
Auxin response factor 12	Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	probable	Q258Y5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WID, chain A
Confidence level:very confident
Coverage over the Query: 38-149
View the alignment between query and template
View the model in PyMOL

Template: 2KKC, chain A
Confidence level:probable
Coverage over the Query: 607-673
View the alignment between query and template
View the model in PyMOL