Citrus Sinensis ID: 004857


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------
MNISEAPEANGSADVHVDPCVMDPQDIALISNNGPAAVSFSSSPCPDGTETSRNPRIDDTNSKNAGLEDVASVSAASQSDVSRAESRMRKKQEEQKYQGRIMMQQYPSAQQGFQYQVQGVQGQAVSLGMNNAHNAGTYMPSGNPFYPSFQPSGAGVYPSQYNVGGYALNSALFPPFVAGYPSQGPVPMPFDATSGSSFNIRTTSVSTGEGIPHIGSTQHQKFYGHQGLMLQSPFVDPLHMQYFQHPFGDAYNASVQHRLASSGVNGALADPSSKKEPIVAAYMGDQNLQSSLNGGPSISNPRKVGMPVGGYYGGLPGMGVMGQFPTSPIASPVLPSSPVGSTSQLGLRHEMRLPQGLNRNTGIYSGWQGQRTFEGQRTFEDSKKHSFLEELKSSNAQKFELSDIAGRIVEFSVDQHGSRFIQQKLEHCSAEEKVSVFKEVLPHASKLMTDVFGNYVIQKFFEHGSPDQRKELAEKLVGQVLPLSLQMYGCRVIQKALEVIELHQKSQLVLELDGHVMRCVRDQNGNHVIQKCIECVPAEKIEFIISAFRGQVATLSTHPYGCRVIQRVLEHCSDEQQGQCIVDEILESAFALAQDQYGNYVTQHVLERGKSYERTQILSKLAGKIVQMSQHKYASNVVEKCLEYGDTAERELLIEEILGQSEENDNLLVMMKDQYANYVVQKILEKCNEKLRETLISRIRVHCDALKKYTYGKHIVARFEQLYGEGA
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHccHHHHHccccHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcHHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHcccHHccccccHHHHHHHHHcccccHHHHHHHHHHHcHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccc
****************************************************************************************************************************VSLG*********Y*****PFYPSFQPSGAGVYPSQYNVGGYALNSALFPPFVAGYP*****************************IPHIGSTQHQKFYGHQGLMLQSPFVDPLHMQYFQHPFGDAYNASVQH************************************************MPVGGYYGGLPGMGVMG**************************************TGIYS******************************AQKFELSDIAGRIVEFSVDQHGSRFIQQKLEHCSAEEKVSVFKEVLPHASKLMTDVFGNYVIQKFFEHGSPDQRKELAEKLVGQVLPLSLQMYGCRVIQKALEVIELHQKSQLVLELDGHVMRCVRDQNGNHVIQKCIECVPAEKIEFIISAFRGQVATLSTHPYGCRVIQRVLEHCSDEQQGQCIVDEILESAFALAQDQYGNYVTQHVLERGKSYERTQILSKLAGKIVQMSQHKYASNVVEKCLEYGDTAERELLIEEILGQSEENDNLLVMMKDQYANYVVQKILEKCNEKLRETLISRIRVHCDALKKYTYGKHIVARFEQLYG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNISEAPEANGSADVHVDPCVMDPQDIALISNNGPAAVSFSSSPCPDGTETSRNPRIDDTNSKNAGLEDVASVSAASQSDVSRAESRMRKKQEEQKYQGRIMMQQYPSAQQGFQYQVQGVQGQAVSLGMNNAHNAGTYMPSGNPFYPSFQPSGAGVYPSQYNVGGYALNSALFPPFVAGYPSQGPVPMPFDATSGSSFNIRTTSVSTGEGIPHIGSTQHQKFYGHQGLMLQSPFVDPLHMQYFQHPFGDAYNASVQHRLASSGVNGALADPSSKKEPIVAAYMGDQNLQSSLNGGPSISNPRKVGMPVGGYYGGLPGMGVMGQFPTSPIASPVLPSSPVGSTSQLGLRHEMRLPQGLNRNTGIYSGWQGQRTFEGQRTFEDSKKHSFLEELKSSNAQKFELSDIAGRIVEFSVDQHGSRFIQQKLEHCSAEEKVSVFKEVLPHASKLMTDVFGNYVIQKFFEHGSPDQRKELAEKLVGQVLPLSLQMYGCRVIQKALEVIELHQKSQLVLELDGHVMRCVRDQNGNHVIQKCIECVPAEKIEFIISAFRGQVATLSTHPYGCRVIQRVLEHCSDEQQGQCIVDEILESAFALAQDQYGNYVTQHVLERGKSYERTQILSKLAGKIVQMSQHKYASNVVEKCLEYGDTAERELLIEEILGQSEENDNLLVMMKDQYANYVVQKILEKCNEKLRETLISRIRVHCDALKKYTYGKHIVARFEQLYGEGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pumilio homolog 5 Sequence-specific RNA-binding protein that regulates translation and mRNA stability by binding the 3'-UTR of target mRNAs. Binds the APUM-binding elements (APBEs) in the 3'-UTR mRNA sequence of CLV1, PNH, WUS and FAS2.probableQ9LJX4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K49, chain A
Confidence level:very confident
Coverage over the Query: 385-725
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 232-312
View the alignment between query and template
View the model in PyMOL