Citrus Sinensis ID: 004921

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720---

MASSISNPLLTSNFFGSQILISPPTPKTRRLSVSFPFPSRTKRTTQATAILRKELEPNNASSEAASKRRTVTTEATMAALLLSSIAPQALAVDNTPPPPPPPLVQAQPSKPNPSNSSPFGQNLLLTAPKPQSQSSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFSFVGNLLFPFLAFAGLFFLFRRAQGGPGGPGGLGGPMDFGRSKSKFQEVPETGVTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLVGPPGTGKTLLARAVAGEAGVPFFSCAASEFVELFVGVGASRVRDLFEKAKSKAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRFDRQVTVDRPDVAGRVKILQVHSRGKALAKDVDFEKISRRTPGFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKKNAVVSDEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFLGQQMSSQKDYSMATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELFVA

cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHcccEEEEEEECcccEEEEEECcccEEEEEccccHHHHHHHHHcccEEEECccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHcccccccccEEEcccccHHHHHHHHHHccccccEEEccccccEEEcccccHHHHHHHHHHHHccccEEEEEEccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccccccEEEEEEcccccEEEEEcccccccccccccHHHHHHHHHHHHcHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccc

************NFFGSQILI******************************************************TMAALLLS********************************SSPFGQNLLLTAP**************WRYSEFLNAVKKGKVERVRFSKDGSALQLTAVDGRRATVIVPNDPDLIDILAMNGVDISVSEGDSGNGLFSFVGNLLFPFLAFAGLFFLFRRA***************************ETGVTFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLLVGPPGTGKTLLARAVAGEAGVPFFSCAASEFVELFVGVGASRVRDLFEKAKSKAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRPGRFDRQVTVDRPDVAGRVKILQVHSRGKALAKDVDFEKISRRTPGFTGADLQNLMNEAAILAARRDLKEISKDEISDALERIIAGPEKK*****DEKKKLVAYHEAGHALVGALMPEYDPVAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGEENVTTGASNDFMQVSRVARQMVERFGFSKKIGQVAIGGPGGNPFL***********MATADVVDAEVRELVETAYTRAKQIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGKAELF**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ATP-dependent zinc metalloprotease FTSH 1, chloroplastic	Probable ATP-dependent zinc metallopeptidase.	confident	Q5Z974
ATP-dependent zinc metalloprotease FTSH 5, chloroplastic	Part of a complex that function as an ATP-dependent zinc metallopeptidase. Involved in the thylakoid formation and in the removal of damaged D1 in the photosystem II, preventing cell death under high-intensity light conditions. Not involved in the degradation of the light-harvesting complex of photosystem II (LHC II) or in thermotolerance.	confident	Q9FH02
ATP-dependent zinc metalloprotease FTSH, chloroplastic	Seems to act as an ATP-dependent zinc metallopeptidase.	probable	O82150

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IY2, chain A
Confidence level:very confident
Coverage over the Query: 254-506
View the alignment between query and template
View the model in PyMOL

Template: 2DHR, chain A
Confidence level:very confident
Coverage over the Query: 255-717
View the alignment between query and template
View the model in PyMOL

Template: 2LNA, chain A
Confidence level:probable
Coverage over the Query: 139-194
View the alignment between query and template
View the model in PyMOL