BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 004928
(723 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2DCL|A Chain A, Structure Of Ph1503 Protein From Pyrococcus Horikoshii Ot3
pdb|2DCL|B Chain B, Structure Of Ph1503 Protein From Pyrococcus Horikoshii Ot3
pdb|2DCL|C Chain C, Structure Of Ph1503 Protein From Pyrococcus Horikoshii Ot3
Length = 127
Score = 29.6 bits (65), Expect = 5.7, Method: Composition-based stats.
Identities = 16/71 (22%), Positives = 34/71 (47%)
Query: 651 VRGDGMGHAAEGTDALQVSTVSPVVQEAAPQPHDADQPTKVIKVVPHNPRSATESVARIF 710
+ G G +D +++ST P++ E + H+ ++ VIK + + E ++
Sbjct: 49 IYGFGKKSRVHSSDVIRLSTDLPIIVEVVDRGHNIEKVVNVIKPMIKDGMITVEPTIVLW 108
Query: 711 QSIQEERKQYD 721
QEE K+++
Sbjct: 109 VGTQEEIKKFE 119
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.313 0.131 0.396
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 22,598,770
Number of Sequences: 62578
Number of extensions: 981660
Number of successful extensions: 1176
Number of sequences better than 100.0: 16
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 15
Number of HSP's that attempted gapping in prelim test: 1175
Number of HSP's gapped (non-prelim): 16
length of query: 723
length of database: 14,973,337
effective HSP length: 106
effective length of query: 617
effective length of database: 8,340,069
effective search space: 5145822573
effective search space used: 5145822573
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 55 (25.8 bits)