BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 004928
         (723 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2DCL|A Chain A, Structure Of Ph1503 Protein From Pyrococcus Horikoshii Ot3
 pdb|2DCL|B Chain B, Structure Of Ph1503 Protein From Pyrococcus Horikoshii Ot3
 pdb|2DCL|C Chain C, Structure Of Ph1503 Protein From Pyrococcus Horikoshii Ot3
          Length = 127

 Score = 29.6 bits (65), Expect = 5.7,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 34/71 (47%)

Query: 651 VRGDGMGHAAEGTDALQVSTVSPVVQEAAPQPHDADQPTKVIKVVPHNPRSATESVARIF 710
           + G G       +D +++ST  P++ E   + H+ ++   VIK +  +     E    ++
Sbjct: 49  IYGFGKKSRVHSSDVIRLSTDLPIIVEVVDRGHNIEKVVNVIKPMIKDGMITVEPTIVLW 108

Query: 711 QSIQEERKQYD 721
              QEE K+++
Sbjct: 109 VGTQEEIKKFE 119


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.313    0.131    0.396 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 22,598,770
Number of Sequences: 62578
Number of extensions: 981660
Number of successful extensions: 1176
Number of sequences better than 100.0: 16
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 15
Number of HSP's that attempted gapping in prelim test: 1175
Number of HSP's gapped (non-prelim): 16
length of query: 723
length of database: 14,973,337
effective HSP length: 106
effective length of query: 617
effective length of database: 8,340,069
effective search space: 5145822573
effective search space used: 5145822573
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 55 (25.8 bits)