Citrus Sinensis ID: 005098


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710----
MELVQEIVAFHMKHNAEPEAVDLLMEVEDLDLLVEHVDATNFKRTCLYLTSAAKYLPGPDDMLVLDIAYMIYLKFEEFPNALQIALFLDNMQYVKQIFTSCDDLLRKKQFCYILARHGITLELDDDMVPDDDDRYALQDIVNNVKLSEGYLTLARDIEVMEPKSPEDIYKAHLLDGRASAGASVDSARQNLAATFVNAFVNAGFGQDKLMTVPSDASSGGSSGNWLFKNKEHGKMSAAASLGMILLWDVDSGLAQIDKYFHSTDNHVIAGALLGVGIVNCGIRNDCDPALALLSEYVGREDACIRIGAIMGLGISYAGTQNDQIRHKLSTILNDAKSPLDVIAFSAISLGLIYVGSCNEEVAQAIIFALMDRSESELGEPLTRLIPLGLGLLYLGKQESVEATAEVSKTFNEKIRKYCDMTLLSCAYAGTGNVLKVQNLLGHCAQHHEKGEAYQGPAVLGIAMVAMAEELGLEMAIRSLEHLLQYGEQNIRRAVPLALGLLCISNPKVNVMDTLSRLSHDTDSEVAMAAVISLGLIGSGTNNARIAGMLRNLSSYYYKDANLLFCVRIAQGLVHMGKGLLTLNPYHSDRFLLSPTALAGIVTTLFACLDMKAVIVGKYHYVLYFLVLAMQPRMLLTVDENLKPLSVPVRVGQAVDVVGQAGRPKTITGFQTHSTPVLLAAGDRAELATEKYIPLSPILEGFVILKENPDYREDH
cccHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccccHHHHHHHHHcccccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccEEEEEccccccccEEEEEcccccccccccccccccccEEECccEEccccHHHHHHHccccccccccccEEEEcccccccccc
MELVQEIVAFHMKHNAEPEAVDLLMEVEDLDLLVEHVDATNFKRTCLYLTSAAKYLPGPDDMLVLDIAYMIYLKFEEFPNALQIALFLDNMQYVKQIFTSCDDLLRKKQFCYILARHGITLELDDDMVPDDDDRYALQDIVNNVKLSEGYLTLARDIEVMEPKSPEDIYKAHLLDGR********SARQNLAATFVNAFVNAGFGQDKLMTVPSDASSGGSSGNWLFKNKEHGKMSAAASLGMILLWDVDSGLAQIDKYFHSTDNHVIAGALLGVGIVNCGIRNDCDPALALLSEYVGREDACIRIGAIMGLGISYAGTQNDQIRHKLSTILNDAKSPLDVIAFSAISLGLIYVGSCNEEVAQAIIFALMDRSESELGEPLTRLIPLGLGLLYLGKQESVEATAEVSKTFNEKIRKYCDMTLLSCAYAGTGNVLKVQNLLGHCAQHHEKGEAYQGPAVLGIAMVAMAEELGLEMAIRSLEHLLQYGEQNIRRAVPLALGLLCISNPKVNVMDTLSRLSHDTDSEVAMAAVISLGLIGSGTNNARIAGMLRNLSSYYYKDANLLFCVRIAQGLVHMGKGLLTLNPYHSDRFLLSPTALAGIVTTLFACLDMKAVIVGKYHYVLYFLVLAMQPRMLLTVDENLKPLSVPVRVGQAVDVVGQAGRPKTITGFQTHSTPVLLAAGDRAELATEKYIPLSPILEGFVILK*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELVQEIVAFHMKHNAEPEAVDLLMEVEDLDLLVEHVDATNFKRTCLYLTSAAKYLPGPDDMLVLDIAYMIYLKFEEFPNALQIALFLDNMQYVKQIFTSCDDLLRKKQFCYILARHGITLELDDDMVPDDDDRYALQDIVNNVKLSEGYLTLARDIEVMEPKSPEDIYKAHLLDGRASAGASVDSARQNLAATFVNAFVNAGFGQDKLMTVPSDASSGGSSGNWLFKNKEHGKMSAAASLGMILLWDVDSGLAQIDKYFHSTDNHVIAGALLGVGIVNCGIRNDCDPALALLSEYVGREDACIRIGAIMGLGISYAGTQNDQIRHKLSTILNDAKSPLDVIAFSAISLGLIYVGSCNEEVAQAIIFALMDRSESELGEPLTRLIPLGLGLLYLGKQESVEATAEVSKTFNEKIRKYCDMTLLSCAYAGTGNVLKVQNLLGHCAQHHEKGEAYQGPAVLGIAMVAMAEELGLEMAIRSLEHLLQYGEQNIRRAVPLALGLLCISNPKVNVMDTLSRLSHDTDSEVAMAAVISLGLIGSGTNNARIAGMLRNLSSYYYKDANLLFCVRIAQGLVHMGKGLLTLNPYHSDRFLLSPTALAGIVTTLFACLDMKAVIVGKYHYVLYFLVLAMQPRMLLTVDENLKPLSVPVRVGQAVDVVGQAGRPKTITGFQTHSTPVLLAAGDRAELATEKYIPLSPILEGFVILKENPDYREDH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
26S proteasome non-ATPase regulatory subunit 2 1A Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins (By similarity). Required during embryogenesis (PubMed:16169895). Required for optimal plant growth and stress responses (PubMed:19605416).probableQ9SIV2
26S proteasome non-ATPase regulatory subunit 2 Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.probableQ4FZT9
26S proteasome non-ATPase regulatory subunit 2 Binds to the intracellular domain of tumor necrosis factor type 1 receptor. The binding domain of TRAP1 and TRAP2 resides outside the death domain of TNFR1.probableQ13200

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ADY, chain A
Confidence level:very confident
Coverage over the Query: 2-650
View the alignment between query and template
View the model in PyMOL
Template: 4B4T, chain N
Confidence level:probable
Coverage over the Query: 192-601
View the alignment between query and template
View the model in PyMOL