Citrus Sinensis ID: 005110
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 714 | ||||||
| 255580419 | 710 | conserved hypothetical protein [Ricinus | 0.984 | 0.990 | 0.668 | 0.0 | |
| 356562279 | 737 | PREDICTED: protein VERNALIZATION INSENSI | 0.997 | 0.966 | 0.655 | 0.0 | |
| 356546032 | 736 | PREDICTED: protein VERNALIZATION INSENSI | 0.995 | 0.966 | 0.657 | 0.0 | |
| 225446034 | 738 | PREDICTED: protein VERNALIZATION INSENSI | 0.995 | 0.963 | 0.653 | 0.0 | |
| 357479623 | 730 | Protein VERNALIZATION INSENSITIVE [Medic | 0.987 | 0.965 | 0.630 | 0.0 | |
| 449457169 | 737 | PREDICTED: protein VERNALIZATION INSENSI | 0.997 | 0.966 | 0.591 | 0.0 | |
| 224126067 | 679 | predicted protein [Populus trichocarpa] | 0.928 | 0.976 | 0.631 | 0.0 | |
| 297735403 | 652 | unnamed protein product [Vitis vinifera] | 0.880 | 0.964 | 0.604 | 0.0 | |
| 449507054 | 734 | PREDICTED: protein VERNALIZATION INSENSI | 0.992 | 0.965 | 0.590 | 0.0 | |
| 380710177 | 739 | vernalization insensitive 3 [Solanum lyc | 0.995 | 0.962 | 0.570 | 0.0 |
| >gi|255580419|ref|XP_002531036.1| conserved hypothetical protein [Ricinus communis] gi|223529389|gb|EEF31353.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 961 bits (2483), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 482/721 (66%), Positives = 573/721 (79%), Gaps = 18/721 (2%)
Query: 1 MEEKRELVYQLSKQSHSASETLRSWTRQEILQILCAELGKERKYTGLTKLKIIENLLKLV 60
M+EKRELVYQLSK S ASE L+SW+RQEILQILC E+GKERKYTGLTKLKIIE+LLK+V
Sbjct: 1 MDEKRELVYQLSKCS-GASEMLQSWSRQEILQILCVEMGKERKYTGLTKLKIIEHLLKIV 59
Query: 61 SEKKSGEREAKTDIEPQSSPASSQRPSKRQRKNDNPARLPVPVTDAAMNNSGSDLVNAIY 120
SEKK+GE E TD E +SSPAS +R SKRQRK DNP+RL VPV A +N+G+DL N IY
Sbjct: 60 SEKKAGECEVTTDAETESSPASVRRSSKRQRKIDNPSRLTVPVNYTATSNAGNDLANVIY 119
Query: 121 CKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECA 180
CKNSACRATL+++D FCKRCSCCIC KYDDNKDPSLWLTCSS+PPF +CGMSCHL+CA
Sbjct: 120 CKNSACRATLKQDDAFCKRCSCCICYKYDDNKDPSLWLTCSSDPPFQAVTCGMSCHLDCA 179
Query: 181 LKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQ 240
LK+E SGIGKD G DGSF CI+C KVNDLLGCW+KQL++AK+TRRVDILCYRLSL Q
Sbjct: 180 LKHESSGIGKD----GYDGSFRCIACWKVNDLLGCWRKQLLMAKDTRRVDILCYRLSLSQ 235
Query: 241 KLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACAVE 300
KL++ + KY+NL +IVD+AVK LEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCA A+E
Sbjct: 236 KLISRSGKYQNLYEIVDEAVKKLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCAFALE 295
Query: 301 SLDKMISNTI---LPNPSVQGSNVIVPNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLW 357
SLDK++S+T P + N+ +V+ EDV +TSLTVVLGSED S ++ YTLW
Sbjct: 296 SLDKLLSSTTAHSFSAPVITDLNLTASTIVRIEDVNSTSLTVVLGSEDTSLDTVVGYTLW 355
Query: 358 HRRAHE-GFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGT-TELGRCEIWFSTGS 415
HR+ + G+PA PTCTLF PNTRFVVTGLC AT+Y FK VS N E+G CE+ T
Sbjct: 356 HRKTRDTGYPAEPTCTLFVPNTRFVVTGLCSATDYHFKAVSFNDERREMGTCEVRCCT-- 413
Query: 416 SRDEVTNCSVIERSQSPATNCSSLSNPSSVEDETNNVTPDRDPNDAQVNNYYTYSKETDK 475
+DEV NCS +ERSQSPATNCSSLSNPSSVEDETN+ P D + NY +Y K+ +K
Sbjct: 414 -QDEVPNCSAVERSQSPATNCSSLSNPSSVEDETNHNAPCGDQTVNRAYNYPSYCKDGNK 472
Query: 476 IASTNLCDDAIDCTVLGRGTTPADAVSLLDEERANNIDGSMPDSHVQKLESKHPPEGRII 535
I S+N+ + I C +G G T +AV LLDEE + SMP +QKL+++H E +I+
Sbjct: 473 IVSSNVLNGIISCAGMGEGRTLTNAVPLLDEEHTVQVVTSMPCCDMQKLQNEHSHEDQIV 532
Query: 536 EEMSTDNGVDTPVPTGMECVPY--MRSLEAGLPITPCKIEILKDAQARNGRSKLNSKDME 593
+E ST+NG D P+ T +ECVP+ ++E LPITPCK++++KD Q R+GRSK ++KD+
Sbjct: 533 DETSTENGSDAPIHTDLECVPFEGKGNIETSLPITPCKLDMIKDGQGRHGRSKSSNKDLL 592
Query: 594 NGTGNRDEPQDGSTSKKRSSESRDEDCTANGLSDMDFEHCVKVIRWLECEGHIERNFRQK 653
NGTG +EPQD STSKKRS E RDE+CT SD DFE+ VKVIR LECEGHIE+NFRQK
Sbjct: 593 NGTGKGEEPQDASTSKKRSGERRDEECTH---SDRDFEYYVKVIRLLECEGHIEKNFRQK 649
Query: 654 FLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCISSRRSSVVPAGFCMKLW 713
FLTWYSLRATPQEVR+VK FVDTF++DPASLAEQL+DTFS+CISSRRSSVVPAGFCMKLW
Sbjct: 650 FLTWYSLRATPQEVRVVKAFVDTFIQDPASLAEQLVDTFSECISSRRSSVVPAGFCMKLW 709
Query: 714 H 714
H
Sbjct: 710 H 710
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356562279|ref|XP_003549399.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356546032|ref|XP_003541436.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225446034|ref|XP_002270335.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357479623|ref|XP_003610097.1| Protein VERNALIZATION INSENSITIVE [Medicago truncatula] gi|355511152|gb|AES92294.1| Protein VERNALIZATION INSENSITIVE [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449457169|ref|XP_004146321.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Cucumis sativus] gi|449502927|ref|XP_004161782.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224126067|ref|XP_002329653.1| predicted protein [Populus trichocarpa] gi|222870534|gb|EEF07665.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297735403|emb|CBI17843.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449507054|ref|XP_004162921.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|380710177|gb|AFD98847.1| vernalization insensitive 3 [Solanum lycopersicum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 714 | ||||||
| TAIR|locus:2173004 | 620 | VIN3 "VERNALIZATION INSENSITIV | 0.453 | 0.522 | 0.495 | 8.2e-134 | |
| TAIR|locus:2128946 | 714 | VEL1 "vernalization5/VIN3-like | 0.796 | 0.796 | 0.428 | 1.6e-109 | |
| TAIR|locus:2044405 | 529 | VEL2 "AT2G18880" [Arabidopsis | 0.438 | 0.591 | 0.439 | 2.7e-101 | |
| TAIR|locus:2094859 | 602 | VRN5 "AT3G24440" [Arabidopsis | 0.386 | 0.458 | 0.426 | 1.5e-81 | |
| TAIR|locus:2044500 | 239 | VEL3 "AT2G18870" [Arabidopsis | 0.106 | 0.317 | 0.578 | 1.7e-18 | |
| TAIR|locus:2087403 | 1162 | TTA2 "TITANIA 2" [Arabidopsis | 0.198 | 0.122 | 0.246 | 9.7e-06 | |
| UNIPROTKB|Q84N38 | 549 | PVIP "OBERON-like protein" [Ni | 0.127 | 0.165 | 0.294 | 0.00084 |
| TAIR|locus:2173004 VIN3 "VERNALIZATION INSENSITIVE 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 809 (289.8 bits), Expect = 8.2e-134, Sum P(3) = 8.2e-134
Identities = 175/353 (49%), Positives = 227/353 (64%)
Query: 119 IYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLE 178
I C+N ACRA L +D FC+RCSCCIC+K+DDNKDPSLWLTC D+CG SCHLE
Sbjct: 128 ICCENLACRAALGCDDTFCRRCSCCICQKFDDNKDPSLWLTC--------DACGSSCHLE 179
Query: 179 CALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSL 238
C LK +R GIG D LDG FYC C K NDLLGCW+KQ+ VAK TRRVD+LCYRLSL
Sbjct: 180 CGLKQDRYGIGSD----DLDGRFYCAYCGKDNDLLGCWRKQVKVAKETRRVDVLCYRLSL 235
Query: 239 GQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACA 298
GQKL+ T KY+NL +++D+AVK LE +VGPL+G +KM RGIVNRLSSG VQKLC+ A
Sbjct: 236 GQKLLRGTTKYRNLLELMDEAVKKLEGDVGPLSGWAMKMARGIVNRLSSGVHVQKLCSQA 295
Query: 299 VESLDKMISNTILPNPSVQGSNVIVPNMVKFEDVRATSLTVVLGSEDPSPGN---IISYT 355
+E+LDK++S P+ SV G + V+ E+++A S+TV + SE+PS I +
Sbjct: 296 MEALDKVVS----PSESVSGQGDKMT--VRVEEIQARSVTVRVDSEEPSSSTQNKITGFR 349
Query: 356 LWHRRAH-EGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGTTELGRCEIWFSTG 414
L+ R++ E ++ C ++ P T + GL P TE+ +VVS N +L E+ F+T
Sbjct: 350 LFCRKSKDEECSSQGNCVVYLPETTSAIQGLEPDTEFCLRVVSFNEEGDLDESELRFTT- 408
Query: 415 SSRDEVTNCSVIERSQSPATNCSS--LSNPSSVEDETNNVTPDRDPNDAQVNN 465
+D+ QSP TN SS SNPS EDE+NNV + +N
Sbjct: 409 -LKDDGDEAG---DQQSPLTNSSSGLCSNPSLPEDESNNVNKSCSKGNGDKDN 457
|
|
| TAIR|locus:2128946 VEL1 "vernalization5/VIN3-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044405 VEL2 "AT2G18880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094859 VRN5 "AT3G24440" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044500 VEL3 "AT2G18870" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2087403 TTA2 "TITANIA 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q84N38 PVIP "OBERON-like protein" [Nicotiana benthamiana (taxid:4100)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 714 | |||
| pfam07227 | 446 | pfam07227, DUF1423, Protein of unknown function (D | 3e-07 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 5e-06 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 2e-04 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 2e-04 |
| >gnl|CDD|219342 pfam07227, DUF1423, Protein of unknown function (DUF1423) | Back alignment and domain information |
|---|
Score = 52.8 bits (127), Expect = 3e-07
Identities = 38/160 (23%), Positives = 68/160 (42%), Gaps = 26/160 (16%)
Query: 121 CKNSACRATLRKEDV----------FCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDS 170
C+N AC++ L +D FC C C +C K+D + W+ C D
Sbjct: 100 CRNIACQSLLPVDDCDCKICSNKKGFCSLCMCVVCSKFDFAVNTCRWVGC--------DV 151
Query: 171 CGMSCHLECALKNE--RSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVV--AKNT 226
C CH +CA+++ R G + F+C +C +++ G + K + A N
Sbjct: 152 CSHWCHTDCAIRDGLIRPGPSLKGGSGTTEMQFHCRACNHTSEMFG-FVKDVFQHCAPNW 210
Query: 227 RRVDILCYRLSLGQKLVNATE--KYKNLSKIVDDAVKMLE 264
R + L L +K+ +E + K L ++ ++ L+
Sbjct: 211 DR-ETLIKELDFVRKIFRGSEDARGKKLFWKCEELIEKLK 249
|
This family represents a conserved region approximately 500 residues long within a number of Arabidopsis thaliana proteins of unknown function. Length = 446 |
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 714 | |||
| PF07227 | 446 | DUF1423: Protein of unknown function (DUF1423); In | 100.0 | |
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 98.58 | |
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 97.98 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 97.08 | |
| KOG4221 | 1381 | consensus Receptor mediating netrin-dependent axon | 95.69 | |
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 95.6 | |
| KOG3513 | 1051 | consensus Neural cell adhesion molecule L1 [Signal | 94.09 | |
| KOG4221 | 1381 | consensus Receptor mediating netrin-dependent axon | 93.97 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 93.96 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 93.21 | |
| KOG3513 | 1051 | consensus Neural cell adhesion molecule L1 [Signal | 85.63 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 84.92 | |
| PF07498 | 43 | Rho_N: Rho termination factor, N-terminal domain; | 82.16 |
| >PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-52 Score=450.38 Aligned_cols=153 Identities=39% Similarity=0.770 Sum_probs=143.7
Q ss_pred CCCCCCcccccccccccccccCCc----------CCcCCceeeeeccccCCCCCccEEecCCCCCCCCCcccchhhhhhh
Q 005110 111 SGSDLVNAIYCKNSACRATLRKED----------VFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECA 180 (714)
Q Consensus 111 ~~~~~~~~~~C~N~aCra~L~~ed----------~FCr~CsC~IC~kfD~nkd~~~Wl~C~s~~~~~~~~Cgh~cHleCA 180 (714)
.=.++|.+.+|||+||||+||++| |||++||||||+|||+|+|||+||+|| +||||||+|||
T Consensus 90 ~LveiFl~~rCrN~aC~s~LP~ddc~C~iC~~~~gFC~~C~C~iC~kfD~~~n~~~Wi~Cd--------~CgH~cH~dCA 161 (446)
T PF07227_consen 90 ELVEIFLYKRCRNLACRSQLPVDDCDCKICCSEPGFCRRCMCCICSKFDDNKNTCSWIGCD--------VCGHWCHLDCA 161 (446)
T ss_pred HHHHHHHHHhcCCHHhhccCCccccCcchhcCCCCccccCCccccCCcccCCCCeeEEecc--------CCCceehhhhh
Confidence 345689999999999999999976 999999999999999999999999998 99999999999
Q ss_pred hhcccccccc--CCCccCcceeEEeccCCCccchhHHHHHHHHHhhccccchhhhhhhhchhhhccccH--HHHHHHHHH
Q 005110 181 LKNERSGIGK--DRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATE--KYKNLSKIV 256 (714)
Q Consensus 181 Lr~~~~G~~~--~g~~~~lD~~f~C~~Cgk~sdLlg~w~Kql~~ake~rrvD~Lc~rL~l~~kll~GS~--~~k~L~~~v 256 (714)
||+++||+|. .|+.+++||+|||++|||+|||||||+++|.+|+++||+|+||+||++++|||+||+ +||+||+++
T Consensus 162 Lr~~~i~~G~s~~g~~g~~d~~f~C~~C~~~seLlG~vk~vf~~ca~~~~~d~L~~eL~l~~rIf~GSed~rgk~L~~~~ 241 (446)
T PF07227_consen 162 LRHELIGTGPSVKGSIGTLDMQFHCRACGKTSELLGFVKKVFQTCAKAWRVDVLCKELDLVRRIFRGSEDYRGKELHEKV 241 (446)
T ss_pred cccccccCCccCCCCCccCceEEEccCCCChhhHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHhhCccchhHHHHHHHH
Confidence 9999997765 466688999999999999999999999999999999999999999999999999999 479999999
Q ss_pred HHHHHHhhhccCCCC
Q 005110 257 DDAVKMLEDEVGPLT 271 (714)
Q Consensus 257 e~A~~KLe~evgpl~ 271 (714)
++|++|||++++++.
T Consensus 242 e~al~KL~~~~~~~~ 256 (446)
T PF07227_consen 242 EEALAKLENGVIDSS 256 (446)
T ss_pred HHHHHHHhCCCCCHH
Confidence 999999999997653
|
Amongst the gene products is a well-conserved family of 130.7kDa proteins that share no sequence similarity with any other known proteins, other than in plants. The sequences are characterised by an N-terminal domain of variable length, a central cysteine-rich region and a relatively acidic C-terminal domain. The sequences may possess a PHD finger. |
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >KOG3513 consensus Neural cell adhesion molecule L1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3513 consensus Neural cell adhesion molecule L1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF07498 Rho_N: Rho termination factor, N-terminal domain; InterPro: IPR011112 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 714 | |||
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 1e-09 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 1e-09 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 1e-09 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 2e-09 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 1e-08 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 2e-08 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 2e-08 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 2e-08 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 5e-08 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 6e-08 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 9e-08 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 1e-07 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 6e-07 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 9e-06 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 1e-07 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 2e-07 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 3e-06 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 2e-07 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 2e-07 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 1e-06 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 5e-05 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 2e-07 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 1e-05 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 3e-07 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 4e-07 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 1e-05 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 5e-07 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 5e-07 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 2e-06 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 2e-06 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 3e-05 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 6e-07 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 8e-07 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 9e-07 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 3e-06 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 1e-05 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 2e-06 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 3e-06 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 3e-06 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 4e-06 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-06 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 5e-06 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 5e-06 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 7e-06 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 7e-06 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 8e-06 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 8e-06 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 8e-06 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 1e-05 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 1e-05 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 1e-05 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 2e-05 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 4e-05 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 2e-05 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 2e-05 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 2e-05 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 9e-05 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-05 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 3e-05 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 1e-04 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 3e-05 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 3e-05 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 3e-05 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 3e-05 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 4e-05 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 5e-05 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 5e-05 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 7e-05 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 8e-05 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 8e-05 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 1e-04 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 1e-04 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 1e-04 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 1e-04 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 1e-04 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 1e-04 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 2e-04 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 2e-04 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 3e-04 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 3e-04 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 3e-04 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-04 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 4e-04 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-04 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 5e-04 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 7e-04 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 8e-04 |
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
Score = 55.1 bits (133), Expect = 1e-09
Identities = 21/94 (22%), Positives = 34/94 (36%), Gaps = 4/94 (4%)
Query: 324 PNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVT 383
P +K ++ T+ V + P I + T L + T +T
Sbjct: 5 PFNIKVTNITLTTAVV---TWQPPILPIEGILV-TFGRKNDPSDETTVDLTSSITSLTLT 60
Query: 384 GLCPATEYQFKVVSSNGTTELGRCEIWFSTGSSR 417
L P T Y+ ++V+ NG F+TGS
Sbjct: 61 NLEPNTTYEIRIVARNGQQYSPPVSTTFTTGSLE 94
|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 714 | |||
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 98.74 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 98.72 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 98.72 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 98.65 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 98.65 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 98.64 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 98.64 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 98.59 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 98.57 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 98.55 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 98.55 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 98.55 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 98.53 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 98.51 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 98.5 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 98.49 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 98.48 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.46 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 98.46 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 98.46 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 98.45 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.44 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 98.43 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 98.42 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 98.42 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 98.42 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 98.42 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 98.41 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 98.41 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 98.39 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 98.38 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.38 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 98.38 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 98.37 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.36 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 98.36 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.35 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 98.34 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 98.33 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 98.31 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 98.29 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 98.29 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 98.28 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 98.26 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 98.26 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 98.26 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 98.23 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 98.23 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 98.2 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 98.19 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 98.18 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 98.18 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 98.17 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 98.17 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 98.16 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 98.14 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 98.13 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 98.13 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 98.12 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 98.11 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 98.1 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 98.1 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 98.09 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 98.06 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 98.04 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 98.04 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 98.03 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 98.03 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 98.02 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 98.02 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 98.02 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 98.02 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 98.02 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 98.01 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 98.01 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 97.99 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 97.98 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 97.95 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 97.94 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 97.91 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 97.91 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 97.89 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 97.87 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 97.86 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 97.86 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 97.83 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 97.83 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 97.83 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 97.82 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 97.82 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 97.82 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 97.81 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 97.8 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 97.79 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 97.76 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 97.76 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 97.76 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 97.76 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 97.71 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 97.67 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 97.67 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 97.67 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 97.6 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 97.59 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 97.56 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 97.54 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 97.53 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 97.36 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 97.36 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 97.34 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 97.32 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 97.31 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 97.3 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 97.22 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 97.13 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 97.06 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 97.04 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 97.03 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 97.01 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 97.0 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 96.99 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 96.92 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 96.88 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 96.64 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 96.63 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 96.6 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 96.5 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 96.38 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 96.31 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 96.2 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 96.18 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 96.17 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 96.15 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 96.13 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 95.91 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 95.91 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 95.59 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 95.49 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 95.16 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 95.07 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 95.01 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 94.99 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 94.88 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 94.87 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 94.71 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 94.38 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 93.83 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 93.53 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 93.38 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 93.21 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 93.1 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 92.93 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 92.76 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 92.71 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 91.42 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 90.24 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 89.75 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 89.41 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 87.79 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 87.64 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 86.88 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 85.87 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 85.27 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 83.78 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 83.7 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 82.23 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 82.12 | |
| 2hft_A | 218 | Human tissue factor; coagulation factor; 1.69A {Ho | 80.43 |
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=98.74 E-value=4.3e-08 Score=83.61 Aligned_cols=91 Identities=23% Similarity=0.244 Sum_probs=72.0
Q ss_pred cCceEEEEEeeceeEEEEeCcCCCCCCCcceEEEEeeecCCC-CCCCCceeeecCCceeEeecCCcceeeeEEEEeccCC
Q 005110 323 VPNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEG-FPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGT 401 (714)
Q Consensus 323 ~~~~~rFE~vt~tSv~vvL~~~~~s~~~i~Gy~LWhrks~~~-y~~ept~~~~~p~~r~~vs~L~P~TEY~fkvvsF~~~ 401 (714)
++..+++.+++++||+|-+.... ..|.||.|+|+..... ... ...+....+.+.|.||.|.|+|.|+|.+++..
T Consensus 4 ~P~~l~~~~~~~~sv~lsW~pP~---~~i~~Y~v~y~~~~~~~~~~--~~~~~~~~t~~~i~~L~p~t~Y~~~V~A~n~~ 78 (100)
T 3b83_A 4 PPFNIKVTNITLTTAVVTWQPPI---LPIEGILVTFGRKNDPSDET--TVDLTSSITSLTLTNLEPNTTYEIRIVARNGQ 78 (100)
T ss_dssp CCEEEEEESCCSSCEEEEEECCS---SCCSEEEEEEEESSCTTTCE--EEEECTTEEEEEECSCCTTCEEEEEEEEEETT
T ss_pred cCCccEEEEecCCEEEEEEcCCc---ccCCEEEEEEEECCCCCCce--EEEECCcceEEEECCCCCCCEEEEEEEEEeCC
Confidence 44578999999999999986553 3699999999977543 211 23466788999999999999999999999999
Q ss_pred ccCcceeeEEecCcccc
Q 005110 402 TELGRCEIWFSTGSSRD 418 (714)
Q Consensus 402 ~elg~~E~k~~T~s~e~ 418 (714)
|.=-.......|...+.
T Consensus 79 g~s~p~~~~~~~~~~~~ 95 (100)
T 3b83_A 79 QYSPPVSTTFTTGSLEH 95 (100)
T ss_dssp EECCCEEEEEECCCCCC
T ss_pred CCCCCEEEEEEEEeeec
Confidence 87767777777765543
|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 714 | ||||
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 1e-07 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 2e-07 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 3e-07 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 8e-07 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 9e-07 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-06 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 2e-06 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 5e-06 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 5e-06 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 1e-05 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-05 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-05 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 2e-05 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 3e-05 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 3e-05 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 4e-05 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 4e-05 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 5e-05 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 5e-05 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 6e-05 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 6e-05 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 8e-05 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 9e-05 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 1e-04 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 1e-04 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 2e-04 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 2e-04 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 2e-04 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 3e-04 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 4e-04 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 4e-04 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 4e-04 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 6e-04 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 7e-04 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 7e-04 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 9e-04 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 0.001 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 0.001 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 0.001 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 0.001 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 0.002 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 0.002 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 0.002 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 0.003 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 0.004 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 0.004 |
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Tenascin-X species: Human (Homo sapiens) [TaxId: 9606]
Score = 47.9 bits (113), Expect = 1e-07
Identities = 18/94 (19%), Positives = 31/94 (32%), Gaps = 6/94 (6%)
Query: 324 PNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVT 383
P ++ ++V + + P Y L L T +
Sbjct: 5 PRDLEAKEVTPRTALLTW---TEPPVRPAGYLLSFHTPGGQTQ---EILLPGGITSHQLL 58
Query: 384 GLCPATEYQFKVVSSNGTTELGRCEIWFSTGSSR 417
GL P+T Y ++ + G + L F+TG R
Sbjct: 59 GLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLR 92
|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 714 | |||
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 98.92 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.91 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.86 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.85 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.84 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 98.83 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.8 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.79 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 98.78 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.77 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 98.76 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.73 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.7 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 98.69 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 98.66 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 98.63 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.62 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.61 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.61 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.6 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 98.55 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 98.55 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 98.55 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 98.53 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.52 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.52 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 98.52 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 98.47 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.46 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.44 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.41 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 98.41 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 98.4 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 98.39 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 98.37 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 98.36 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.35 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 98.33 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 98.33 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.33 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 98.3 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.3 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 98.28 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 98.27 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 98.27 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.26 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 98.25 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 98.23 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 98.22 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 98.21 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 98.21 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 98.19 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 98.19 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 98.15 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 98.15 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 98.11 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 98.1 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 98.08 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 98.07 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 98.06 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 98.03 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 97.99 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 97.98 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 97.89 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 97.88 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 97.79 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 97.79 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 97.78 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 97.74 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 97.7 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 97.67 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 97.55 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 97.54 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 97.42 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 97.41 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 97.27 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 97.11 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 96.87 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 96.87 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 96.76 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 96.14 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 96.11 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 95.77 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 93.91 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 93.84 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 93.73 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 93.28 | |
| d2c4fu1 | 116 | Extracellular region of human tissue factor {Human | 92.44 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 88.86 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 87.4 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 82.39 | |
| d1xzwa1 | 119 | Purple acid phosphatase, N-terminal domain {Sweet | 81.69 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 81.33 |
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Hedgehog receptor iHog species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=98.92 E-value=6.7e-10 Score=91.55 Aligned_cols=84 Identities=19% Similarity=0.202 Sum_probs=64.4
Q ss_pred CcccCceEEEEEeeceeEEEEeCcCCC-CCCCcceEEEEeeecCCCCCCCCceeeecCCceeEeecCCcceeeeEEEEec
Q 005110 320 NVIVPNMVKFEDVRATSLTVVLGSEDP-SPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSS 398 (714)
Q Consensus 320 ~l~~~~~~rFE~vt~tSv~vvL~~~~~-s~~~i~Gy~LWhrks~~~y~~ept~~~~~p~~r~~vs~L~P~TEY~fkvvsF 398 (714)
.++++..++++.++++||.|.++.... ....|.||+|+||.....-...-..+.....+.+.|+||.|.|.|.|||.+|
T Consensus 6 P~~~P~~~~v~~~s~tsv~l~W~~P~~~~~~~i~gY~i~y~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~ 85 (95)
T d2ibga1 6 PMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSF 85 (95)
T ss_dssp CCCCCEECCCBCCSSSCEEEEEECCTTCCGGGCCEEEEEEEETTCCSCCEEEEEECTTCCEEEECSCCTTCEEEEEEEEE
T ss_pred CCCCCcCeEEEEeCCCEEEEEEEeeeeccCCcccccceeEeeeeecceeeeeeccCCceeEEEEeeccCCeEEEEEEEEE
Confidence 345666789999999999999986543 4566999999999876541111112334567889999999999999999999
Q ss_pred cCCcc
Q 005110 399 NGTTE 403 (714)
Q Consensus 399 ~~~~e 403 (714)
++.|+
T Consensus 86 n~~G~ 90 (95)
T d2ibga1 86 SAASA 90 (95)
T ss_dssp CSSCB
T ss_pred eCCcc
Confidence 99874
|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|