Citrus Sinensis ID: 005214

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------71
MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAKPGIPARPTAAGRGRGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAMEGGSADKILGVEEEASATPVPDRVQVGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLIEPCTSLRPIRIDGALKVGQKRGRLLINLEEDEQPKKKVRLGSPATQWISVYNARRPMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
ccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccHHHHHHHHcccccccccccccccccccccccccEEEcccccEEEEEEEcccccccEEEEEEcccccccccccccEEEEEEEEcccccccccccHHHHHHHHHcccccccEEEEEEEcccEEEEEEEcccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccccEEEEEEcccccEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccEEEEccccccEEEEEEEcccccHHHHHHHHHHccEEEEEEcccccccEEEEEEccccccccEEEcccccccHHHHHcccccEEEEEEcccccEEEEEEEccccccccEEEEEEccccHHHHHHcccccEEEEEccccccEEEEEEccccccHHHHHHHHHccccccHHHHHHHHcccEEEEEccccccc
cccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccEEEccccEEEEEEEEccccccEEEEEEEEcccccccccccEEEEEEEccccccccccccHHHHHHHHHHccccccccEEEEEEEccEEEEEEEccccEHHHHHccccccccHHHHHHHHHHHHHHHHHHHccHHHccEEcccccHHHEEEccccccccEEEEEEEccHcHHcccccccccccccccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccEEEcHccccccHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccEEEEHHHEcccccccccccccccccccccccccccccccEEcccccccccccccEcccHHHHHHHHHccccccEEEEEEccHHHHHHHHHHcccccccEEEEccHHHccHHHHHHHHHccEEEEEEEEcccccEEEEEEccccccEEEEEEcccccHHHHHHHHccccEEEEEEcccccEEEEEEccccccccEEEEEccccccccccccccccEEEEEcccHcHHEEEEccccccccccHHHHHcccccccHHHHHHHHHHHEHHHHHcccccc
mpelrsgarrskrlddlqpppqpvdqtenwllpaqnrtrrrvgggrgrgnatavakpgiparptaagrgrgirlidldpepcevlPEAAALvaaepvynplevvadkdiameggsadkilgveeeasatpvpdrvqvgnspvyKIERklgkggfgqvyvgrrahggsdrigpDAIEVALKFEhrnskgcnygppyewqvyntlngcygipgvhykgrqgdFYILVMDMLGPSLWDVWNSLGQSicdrmspnmAACIAVEAISILEKLHlkgfvhgdvkpenfllgqpgtadekkLYLIDLGlasrwkdassgqhveydqrpdvfrGTIRYASVHahlgrtgsrrdDLESLAYTLIFLIKgrlpwqgyqgdnkSFLVCKKkmatspelmccfcpapFKQFLEAVTNmkfdeepnyAKLISFFDsliepctslrpiridgALKVGQKRGRLLInleedeqpkkkvrlgspatqWISVYNarrpmkqryhynvsdaRLRQhvdkgnedgLYISCVASASNLWALIMDAGTGFTHQVYELSAIFLHKDWIMEQWEKNYYISSiagstngsslvvmskgtpytqqsykvsesfpfkwinkkwkegFHVTSMTTAGNRWGVVMsrnsgyseqVVELdflypsegihrrwesgyritsmAATADQAAFILsvprrkmvdETQETlrtsafpsthvkekwskNLYIASICYGRTVC
mpelrsgarrskrlddlqpppqpvdqtenwllpaqnrtrrrvgggrgrgnatavakpgiparptaagrgrGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAMEGGSADKILGVEeeasatpvpdrvqvgnspvykierklgkggfgQVYVGRRahggsdriGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASrwkdassgqhveydqrpdvFRGTIRYASVhahlgrtgsrrddLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLIEPCTSLRPIRIDGALKVGQKRGRLLinleedeqpkkkvrlgspatqwisvynarrpmKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVDETQEtlrtsafpsthvkekwsknlyiasicygrtvc
MPELRSGARRSKRlddlqpppqpVDQTENWLLPAQnrtrrrvgggrgrgnatavAKPGIPARPTAAGRGRGIRLIDLDPEPCevlpeaaalvaaepvYNPLEVVADKDIAMEGGSADKILGVEEEASATPVPDRVQVGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLIEPCTSLRPIRIDGALKVGQKRGRLLINLEEDEQPKKKVRLGSPATQWISVYNARRPMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
*********************************************************************RGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAME************************VGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLIEPCTSLRPIRIDGALKVGQKRGRLLINL***************ATQWISVYNARRPMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRK*************FPSTHVKEKWSKNLYIASICYGRT**
****************************************************************************************************************************************VGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLIEPCTSLRPIRIDGALKV********************************************************************CVASASNLWALIMDAGTGFTHQVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRR*****TQ*TLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
************************DQTENWLLPAQNRTR*************AVAKPGIPARPTAAGRGRGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAMEGGSADKILGVEEEASATPVPDRVQVGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLIEPCTSLRPIRIDGALKVGQKRGRLLINLEEDEQPKKKVRLGSPATQWISVYNARRPMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
*********************************************************************RGIRLIDLDPEPC***********************************************PVPDRVQVGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLIEPCTSLRPIRIDGALKVGQ*************************TQWISVYNARRPMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKM**ETQETLRTSAFPSTHVKEKWSKNLYIASICYGRT**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAKPGIPARPTAAGRGRGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAMEGGSADKILGVEEEASATPVPDRVQVGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLIEPCTSLRPIRIDGALKVGQKRGRLLINLEEDEQPKKKVRLGSPATQWISVYNARRPMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query708 2.2.26 [Sep-21-2011]
P42158450 Casein kinase I isoform d no no 0.381 0.6 0.377 9e-51
P40234435 Casein kinase I homolog 2 yes no 0.378 0.616 0.363 2e-49
Q5RC72415 Casein kinase I isoform d yes no 0.379 0.648 0.374 5e-49
Q06486415 Casein kinase I isoform d yes no 0.384 0.655 0.371 1e-48
Q9DC28415 Casein kinase I isoform d yes no 0.384 0.655 0.371 1e-48
P48730415 Casein kinase I isoform d yes no 0.384 0.655 0.371 1e-48
P35508415 Casein kinase I isoform d no no 0.384 0.655 0.371 1e-48
Q8N752337 Casein kinase I isoform a no no 0.374 0.786 0.386 2e-48
O74135439 Casein kinase I homolog 3 no no 0.378 0.610 0.360 2e-48
Q6QNM1324 Casein kinase I OS=Toxopl N/A no 0.382 0.836 0.376 2e-48
>sp|P42158|KC1D_ARATH Casein kinase I isoform delta-like OS=Arabidopsis thaliana GN=At4g26100 PE=2 SV=2 Back     alignment and function desciption
 Score =  202 bits (513), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 175/294 (59%), Gaps = 24/294 (8%)

Query: 136 QVGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPY 195
           +VGN   +++ RK+G G FG++Y+G   H           E+A+K E+  +K       Y
Sbjct: 4   RVGNK--FRLGRKIGSGSFGEIYLGTNIHTNE--------ELAIKLENVKTKHPQL--LY 51

Query: 196 EWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDR-MSPNMAA 254
           E ++Y  L G  G+P V + G +GD+ +LVMD+LGPSL D++N      C R +S     
Sbjct: 52  ESKLYRILQGGTGVPNVKWFGVEGDYNVLVMDLLGPSLEDLFN-----FCSRKLSLKSVL 106

Query: 255 CIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQH 314
            +A + I+ +E  H K F+H D+KP+NFL+G    A++  +Y+ID GLA +++D+++ QH
Sbjct: 107 MLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQ--VYIIDFGLAKKYRDSTTHQH 164

Query: 315 VEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKS- 373
           + Y +  ++  GT RYAS++ HLG   SRRDDLESL Y L++ +KG LPWQG +   K  
Sbjct: 165 IPYRENKNL-TGTARYASMNTHLGIEQSRRDDLESLGYILMYFLKGSLPWQGLKAGTKKQ 223

Query: 374 --FLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLI 425
               + +KK++TS E +C   P+ F  +     +++FD++P+YA L   F  L 
Sbjct: 224 KYERISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKPDYAYLKRIFRDLF 277
Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates. It can phosphorylate a large number of proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|P40234|CKI2_SCHPO Casein kinase I homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki2 PE=1 SV=2 Back     alignment and function description
>sp|Q5RC72|KC1D_PONAB Casein kinase I isoform delta OS=Pongo abelii GN=CSNK1D PE=2 SV=1 Back     alignment and function description
>sp|Q06486|KC1D_RAT Casein kinase I isoform delta OS=Rattus norvegicus GN=Csnk1d PE=1 SV=2 Back     alignment and function description
>sp|Q9DC28|KC1D_MOUSE Casein kinase I isoform delta OS=Mus musculus GN=Csnk1d PE=1 SV=2 Back     alignment and function description
>sp|P48730|KC1D_HUMAN Casein kinase I isoform delta OS=Homo sapiens GN=CSNK1D PE=1 SV=2 Back     alignment and function description
>sp|P35508|KC1D_BOVIN Casein kinase I isoform delta OS=Bos taurus GN=CSNK1D PE=2 SV=2 Back     alignment and function description
>sp|Q8N752|KC1AL_HUMAN Casein kinase I isoform alpha-like OS=Homo sapiens GN=CSNK1A1L PE=2 SV=2 Back     alignment and function description
>sp|O74135|CKI3_SCHPO Casein kinase I homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cki3 PE=3 SV=1 Back     alignment and function description
>sp|Q6QNM1|KC1_TOXGO Casein kinase I OS=Toxoplasma gondii PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query708
255568924705 casein kinase, putative [Ricinus communi 0.991 0.995 0.917 0.0
449484907742 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.994 0.948 0.876 0.0
449459598708 PREDICTED: uncharacterized protein LOC10 0.994 0.994 0.876 0.0
225441621708 PREDICTED: uncharacterized protein LOC10 0.992 0.992 0.869 0.0
357508675708 Casein kinase I isoform alpha [Medicago 0.994 0.994 0.886 0.0
356560953709 PREDICTED: uncharacterized protein LOC10 0.994 0.992 0.872 0.0
224144790720 predicted protein [Populus trichocarpa] 0.991 0.975 0.871 0.0
15228670701 protein kinase-like protein [Arabidopsis 0.990 1.0 0.851 0.0
297833078702 kinase family protein [Arabidopsis lyrat 0.990 0.998 0.853 0.0
15238765691 protein kinase-like protein [Arabidopsis 0.974 0.998 0.830 0.0
>gi|255568924|ref|XP_002525432.1| casein kinase, putative [Ricinus communis] gi|223535245|gb|EEF36922.1| casein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1338 bits (3464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/711 (91%), Positives = 673/711 (94%), Gaps = 9/711 (1%)

Query: 1   MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQNRTRRRVGGGRGRGNATAVAK---P 57
           MPELRSGARRSKRLDDLQ   QPV+  +NW+ PAQN+TRRRVGG    GNATAVAK   P
Sbjct: 1   MPELRSGARRSKRLDDLQTLQQPVNPADNWIQPAQNKTRRRVGGRGRGGNATAVAKGASP 60

Query: 58  GIPARPTAAGRGRGIRLIDLDPEPCEVLPEAAALVAAEPVYNPLEVVADKDIAMEGGSAD 117
            IP RPTAAGRGRGIRLIDLDPEPCEV  EAAAL AAEP YN +EVVADKDIAME GSAD
Sbjct: 61  AIPTRPTAAGRGRGIRLIDLDPEPCEV--EAAALRAAEPGYNRVEVVADKDIAMEDGSAD 118

Query: 118 KILGVEEEASATPVPDRVQVGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEV 177
           K +GVEEE S TPVP+RVQVGNSP YKIERKLGKGGFGQVYVGRR  GG+DR GPDAIEV
Sbjct: 119 KAMGVEEEGSTTPVPERVQVGNSPTYKIERKLGKGGFGQVYVGRRVSGGTDRTGPDAIEV 178

Query: 178 ALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVW 237
           ALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIP VHYKGRQGDFYILVMDMLGPSLWDVW
Sbjct: 179 ALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPWVHYKGRQGDFYILVMDMLGPSLWDVW 238

Query: 238 NSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYL 297
           NSLGQS    MSPNM ACIAVEAISILEKLH+KGFVHGDVKPENFLLGQPGTADEKKLYL
Sbjct: 239 NSLGQS----MSPNMVACIAVEAISILEKLHMKGFVHGDVKPENFLLGQPGTADEKKLYL 294

Query: 298 IDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFL 357
           IDLGLASRWKD SSGQHV+YDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFL
Sbjct: 295 IDLGLASRWKDQSSGQHVDYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFL 354

Query: 358 IKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKL 417
           +KGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKL
Sbjct: 355 LKGRLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKL 414

Query: 418 ISFFDSLIEPCTSLRPIRIDGALKVGQKRGRLLINLEEDEQPKKKVRLGSPATQWISVYN 477
           ISFFDSLIEPC  LRPIRIDGALKVGQKRGRLLINLEEDEQPKKKVRLGSPATQWISVYN
Sbjct: 415 ISFFDSLIEPCVPLRPIRIDGALKVGQKRGRLLINLEEDEQPKKKVRLGSPATQWISVYN 474

Query: 478 ARRPMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELS 537
           ARRPMKQRYHYNV+DARLRQHVDKGNEDGLYISCVASA+NLWALIMDAGTGFT QVYELS
Sbjct: 475 ARRPMKQRYHYNVADARLRQHVDKGNEDGLYISCVASATNLWALIMDAGTGFTSQVYELS 534

Query: 538 AIFLHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKW 597
           A+FLHKDWIMEQWEKN+YISSIAG++NGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKW
Sbjct: 535 AVFLHKDWIMEQWEKNFYISSIAGASNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKW 594

Query: 598 KEGFHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATAD 657
           KEGFHVTSMTTAGNRWGVVMSRN+GYS+QVVELDFLYPSEGIHRRWESGYRITSMAATAD
Sbjct: 595 KEGFHVTSMTTAGNRWGVVMSRNAGYSDQVVELDFLYPSEGIHRRWESGYRITSMAATAD 654

Query: 658 QAAFILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC 708
           QAAFILS+P+RKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC
Sbjct: 655 QAAFILSIPKRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC 705

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449484907|ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449459598|ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus] Back     alignment and taxonomy information
>gi|225441621|ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera] gi|147816350|emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357508675|ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula] gi|355499641|gb|AES80844.1| Casein kinase I isoform alpha [Medicago truncatula] Back     alignment and taxonomy information
>gi|356560953|ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 [Glycine max] Back     alignment and taxonomy information
>gi|224144790|ref|XP_002325416.1| predicted protein [Populus trichocarpa] gi|222862291|gb|EEE99797.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15228670|ref|NP_187044.1| protein kinase-like protein [Arabidopsis thaliana] gi|6223639|gb|AAF05853.1|AC011698_4 putative casein kinase [Arabidopsis thaliana] gi|332640493|gb|AEE74014.1| protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297833078|ref|XP_002884421.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297330261|gb|EFH60680.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15238765|ref|NP_197320.1| protein kinase-like protein [Arabidopsis thaliana] gi|9758901|dbj|BAB09477.1| casein kinase-like protein [Arabidopsis thaliana] gi|332005134|gb|AED92517.1| protein kinase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query708
TAIR|locus:2079329701 AT3G03940 [Arabidopsis thalian 0.990 1.0 0.823 0.0
TAIR|locus:2172344691 AT5G18190 [Arabidopsis thalian 0.911 0.933 0.854 1.00000000001e-313
TAIR|locus:2091566703 AT3G13670 [Arabidopsis thalian 0.850 0.856 0.754 1.3e-266
TAIR|locus:2043475676 AT2G25760 [Arabidopsis thalian 0.830 0.869 0.733 1e-255
TAIR|locus:2079334287 AT3G03930 "AT3G03930" [Arabido 0.344 0.850 0.742 4.4e-100
CGD|CAL0001885495 YCK2 [Candida albicans (taxid: 0.382 0.547 0.358 1.2e-47
UNIPROTKB|Q59YS3495 YCK2 "Likely protein kinase" [ 0.382 0.547 0.358 1.2e-47
UNIPROTKB|E1BEW4340 LOC613515 "Uncharacterized pro 0.401 0.835 0.364 2.6e-47
POMBASE|SPBP35G2.05c435 cki2 "serine/threonine protein 0.378 0.616 0.363 3.3e-47
CGD|CAL0006212378 orf19.2222 [Candida albicans ( 0.391 0.732 0.357 4.2e-47
TAIR|locus:2079329 AT3G03940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3098 (1095.6 bits), Expect = 0., P = 0.
 Identities = 583/708 (82%), Positives = 623/708 (87%)

Query:     1 MPELRSGARRSKRXXXXXXXXXXVDQTENWLLPAQXXXXXXXXXXXXXXXXXXXAKPGIP 60
             MPELRSGARRS+R          V+Q EN +LP Q                   AK   P
Sbjct:     1 MPELRSGARRSRRLDEQPNPPL-VEQAENIVLPPQTATRRRGGGRGRGNAAL--AKGAAP 57

Query:    61 ARPTAAGRGRGIRLIDLDPEPCXXXXXXXXXXXXXXXYNPLEVVADKDIAMEGGSADKIL 120
              RPTAAGRGRGIRL DL+PEPC                N +E VADKDIA EGGSA+K++
Sbjct:    58 PRPTAAGRGRGIRLTDLEPEPCEVRPAAGAIGATEPALNRVEGVADKDIAAEGGSAEKVV 117

Query:   121 GVEEEASATPVPDRVQVGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALK 180
             G+EE++S  PVP+RVQVGNSPVYK ERKLGKGGFGQVYVGRR  GGSDRIG DAIEVALK
Sbjct:   118 GMEEDSSMGPVPERVQVGNSPVYKTERKLGKGGFGQVYVGRRVSGGSDRIGADAIEVALK 177

Query:   181 FEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSL 240
              EHRNSKGCN+GPPYEWQVYNTLN CYGIP VH+KGRQGDFYILVMDMLGPSLWDVWNSL
Sbjct:   178 LEHRNSKGCNFGPPYEWQVYNTLNSCYGIPAVHHKGRQGDFYILVMDMLGPSLWDVWNSL 237

Query:   241 GQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDL 300
              QS    MSPNM ACIAVEAISILEKLH+KGFVHGDVKPENFLLGQPGTADEKKLYLIDL
Sbjct:   238 AQS----MSPNMVACIAVEAISILEKLHMKGFVHGDVKPENFLLGQPGTADEKKLYLIDL 293

Query:   301 GLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKG 360
             GLASRWKD+ SGQHVEYDQRPDVFRGTIRYAS HAHLGRTGSRRDDLESLAYTLIFL++G
Sbjct:   294 GLASRWKDSHSGQHVEYDQRPDVFRGTIRYASCHAHLGRTGSRRDDLESLAYTLIFLMRG 353

Query:   361 RLPWQGYQGDNKSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISF 420
             RLPWQGYQGDNKSFLVCKKKM+TSPELMCCFCP PFK FLEAVTNMKFDEEPNYAKLIS 
Sbjct:   354 RLPWQGYQGDNKSFLVCKKKMSTSPELMCCFCPPPFKLFLEAVTNMKFDEEPNYAKLISI 413

Query:   421 FDSLIEPCTSLRPIRIDGALKVGQKRGRLLINLEEDEQPKKKVRLGSPATQWISVYNARR 480
             FD+LIEPC   RPIRIDGALKVGQKRGRLLINLEEDEQP+KK+R+GSPATQWISVYNARR
Sbjct:   414 FDTLIEPCAISRPIRIDGALKVGQKRGRLLINLEEDEQPRKKIRIGSPATQWISVYNARR 473

Query:   481 PMKQRYHYNVSDARLRQHVDKGNEDGLYISCVASASNLWALIMDAGTGFTHQVYELSAIF 540
             PMKQRYHYNV+D RL QHV+KGNEDGL+ISCVAS++NLWA+IMDAGTGF+ QVYELS++F
Sbjct:   474 PMKQRYHYNVADLRLAQHVEKGNEDGLFISCVASSANLWAIIMDAGTGFSSQVYELSSVF 533

Query:   541 LHKDWIMEQWEKNYYISSIAGSTNGSSLVVMSKGTPYTQQSYKVSESFPFKWINKKWKEG 600
             LHKDWIMEQWEKNYYISSIAG+ NGSSLVVM+KGTPYTQQSYKVS+SFPFKWINKKWKEG
Sbjct:   534 LHKDWIMEQWEKNYYISSIAGANNGSSLVVMAKGTPYTQQSYKVSDSFPFKWINKKWKEG 593

Query:   601 FHVTSMTTAGNRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA 660
             FHVTSMTTAG+RWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA
Sbjct:   594 FHVTSMTTAGSRWGVVMSRNSGYSEQVVELDFLYPSEGIHRRWESGYRITSMAATADQAA 653

Query:   661 FILSVPRRKMVDETQETLRTSAFPSTHVKEKWSKNLYIASICYGRTVC 708
              ILS+P+RK+ DETQETLRTSAFPSTHVKEKW+KNLYIASICYGRTVC
Sbjct:   654 LILSIPKRKITDETQETLRTSAFPSTHVKEKWAKNLYIASICYGRTVC 701
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2172344 AT5G18190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091566 AT3G13670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043475 AT2G25760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079334 AT3G03930 "AT3G03930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0001885 YCK2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59YS3 YCK2 "Likely protein kinase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEW4 LOC613515 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
POMBASE|SPBP35G2.05c cki2 "serine/threonine protein kinase Cki2" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0006212 orf19.2222 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.110.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00025476001
SubName- Full=Putative uncharacterized protein (Chromosome chr8 scaffold_34, whole genome shotgun sequence); (708 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query708
pfam00069260 pfam00069, Pkinase, Protein kinase domain 5e-29
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-25
PHA02882294 PHA02882, PHA02882, putative serine/threonine kina 5e-24
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-21
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-19
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 9e-12
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-09
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-08
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 5e-08
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 3e-07
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 4e-07
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 6e-06
cd05120155 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphot 7e-06
PRK14879211 PRK14879, PRK14879, serine/threonine protein kinas 1e-05
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 2e-05
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 2e-05
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 1e-04
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 1e-04
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 1e-04
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-04
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-04
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-04
TIGR03724199 TIGR03724, arch_bud32, Kae1-associated kinase Bud3 3e-04
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 3e-04
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 4e-04
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 4e-04
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 5e-04
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 5e-04
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 6e-04
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 7e-04
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 0.001
PRK09605535 PRK09605, PRK09605, bifunctional UGMP family prote 0.001
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 0.001
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 0.001
COG3642204 COG3642, COG3642, Mn2+-dependent serine/threonine 0.001
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 0.002
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 0.002
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 0.002
PLN03225566 PLN03225, PLN03225, Serine/threonine-protein kinas 0.002
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 0.002
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 0.003
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 0.003
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 0.003
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 0.004
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 0.004
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information 
 Score =  116 bits (292), Expect = 5e-29
 Identities = 63/267 (23%), Positives = 100/267 (37%), Gaps = 37/267 (13%)

Query: 143 YKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFE--HRNSKGCNYGPPYEWQVY 200
           Y++ RKLG G FG VY  +    G          VA+K           +     E ++ 
Sbjct: 1   YELLRKLGSGSFGTVYKAKHKGTG--------KIVAVKILKKRSEKSKKDQTARREIRIL 52

Query: 201 NTLNGCYGIPGVHYKG--RQGDFYILVMDMLGP-SLWDVWNSLGQSICDRMSPNMAACIA 257
             L+    +            D   LVM+      L+D  +  G      +S + A  IA
Sbjct: 53  RRLSHPNIVR---LIDAFEDKDHLYLVMEYCEGGDLFDYLSRGG-----PLSEDEAKKIA 104

Query: 258 VEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQHVEY 317
           ++ +  LE LH  G +H D+KPEN LL + G      + + D GLA         + ++ 
Sbjct: 105 LQILRGLEYLHSNGIIHRDLKPENILLDENGV-----VKIADFGLAK--------KLLKS 151

Query: 318 DQRPDVFRGTIRYASVHAHLGRTG-SRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLV 376
                 F GT  Y +    LG  G   + D+ SL   L  L+ G+ P+ G    ++  L+
Sbjct: 152 SSSLTTFVGTPWYMAPEVLLGGNGYGPKVDVWSLGVILYELLTGKPPFSGENILDQLQLI 211

Query: 377 CKKKMAT--SPELMCCFCPAPFKQFLE 401
            +         E          K  ++
Sbjct: 212 RRILGPPLEFDEPKWSSGSEEAKDLIK 238

Length = 260
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|165211 PHA02882, PHA02882, putative serine/threonine kinase; Provisional Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|240159 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>gnl|CDD|237847 PRK14879, PRK14879, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|234331 TIGR03724, arch_bud32, Kae1-associated kinase Bud32 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|236586 PRK09605, PRK09605, bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|226168 COG3642, COG3642, Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 708
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0575592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0661538 consensus MAPK related serine/threonine protein ki 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0582516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0201467 consensus Serine/threonine protein kinase [Signal 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG0611668 consensus Predicted serine/threonine protein kinas 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0589426 consensus Serine/threonine protein kinase [General 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
KOG0690516 consensus Serine/threonine protein kinase [Signal 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
PHA02882294 putative serine/threonine kinase; Provisional 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
KOG0586596 consensus Serine/threonine protein kinase [General 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
KOG0607463 consensus MAP kinase-interacting kinase and relate 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
KOG0986591 consensus G protein-coupled receptor kinase [Signa 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
KOG0671415 consensus LAMMER dual specificity kinases [Signal 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
KOG0696683 consensus Serine/threonine protein kinase [Signal 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 100.0
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 100.0
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 100.0
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 100.0
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 100.0
KOG1290590 consensus Serine/threonine protein kinase [Signal 100.0
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 100.0
KOG0584632 consensus Serine/threonine protein kinase [General 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 100.0
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 100.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 100.0
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 100.0
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 100.0
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG0695593 consensus Serine/threonine protein kinase [Signal 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
KOG06081034 consensus Warts/lats-like serine threonine kinases 100.0
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 100.0
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 100.0
KOG2052513 consensus Activin A type IB receptor, serine/threo 100.0
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 100.0
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 100.0
KOG4257974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 100.0
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.98
KOG3653534 consensus Transforming growth factor beta/activin 99.97
KOG1152772 consensus Signal transduction serine/threonine kin 99.97
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.97
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.97
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.97
PLN03224507 probable serine/threonine protein kinase; Provisio 99.97
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.97
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.97
KOG1027903 consensus Serine/threonine protein kinase and endo 99.97
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.97
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.96
KOG10251177 consensus Epidermal growth factor receptor EGFR an 99.96
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.96
KOG1167418 consensus Serine/threonine protein kinase of the C 99.95
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.95
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.95
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.94
PLN00181 793 protein SPA1-RELATED; Provisional 99.94
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.93
PRK09188365 serine/threonine protein kinase; Provisional 99.92
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.92
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.89
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.86
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.86
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.85
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.84
PRK12274218 serine/threonine protein kinase; Provisional 99.84
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.84
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.84
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.84
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.83
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.83
PRK10345210 hypothetical protein; Provisional 99.8
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.78
smart00090237 RIO RIO-like kinase. 99.77
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.76
PRK14879211 serine/threonine protein kinase; Provisional 99.72
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.71
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.7
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.69
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.66
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.66
KOG1023484 consensus Natriuretic peptide receptor, guanylate 99.65
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.6
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.6
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.58
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.4
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.37
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.33
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.28
KOG06061205 consensus Microtubule-associated serine/threonine 99.25
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.2
KOG3087229 consensus Serine/threonine protein kinase [General 99.12
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.08
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.07
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.97
KOG1243 690 consensus Protein kinase [General function predict 98.95
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.91
KOG1266458 consensus Protein kinase [Signal transduction mech 98.87
COG4248637 Uncharacterized protein with protein kinase and he 98.83
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 98.83
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.73
COG0478304 RIO-like serine/threonine protein kinase fused to 98.68
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.67
PRK09902216 hypothetical protein; Provisional 98.5
KOG0576829 consensus Mitogen-activated protein kinase kinase 98.47
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 98.34
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.31
COG0661517 AarF Predicted unusual protein kinase [General fun 98.27
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 98.27
PF01636239 APH: Phosphotransferase enzyme family This family 98.21
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 98.2
COG1718268 RIO1 Serine/threonine protein kinase involved in c 98.12
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 97.9
KOG1235538 consensus Predicted unusual protein kinase [Genera 97.8
PLN02876 822 acyl-CoA dehydrogenase 97.77
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 97.74
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 97.72
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 97.71
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 97.68
PRK09550401 mtnK methylthioribose kinase; Reviewed 97.45
KOG2268465 consensus Serine/threonine protein kinase [Signal 97.4
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 97.35
TIGR01767370 MTRK 5-methylthioribose kinase. This enzyme is inv 97.28
PRK10593297 hypothetical protein; Provisional 97.24
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 97.12
PRK05231319 homoserine kinase; Provisional 97.11
KOG2270520 consensus Serine/threonine protein kinase involved 97.11
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 97.09
PLN02236344 choline kinase 97.06
PRK12396409 5-methylribose kinase; Reviewed 96.95
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 96.95
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 96.94
KOG1826 2724 consensus Ras GTPase activating protein RasGAP/neu 96.84
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 96.71
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 96.68
KOG1093 725 consensus Predicted protein kinase (contains TBC a 96.51
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 95.99
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 95.69
PTZ00384383 choline kinase; Provisional 95.43
PLN02756418 S-methyl-5-thioribose kinase 95.23
KOG1236565 consensus Predicted unusual protein kinase [Genera 95.08
COG5072488 ALK1 Serine/threonine kinase of the haspin family 95.07
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 94.73
PRK11768325 serine/threonine protein kinase; Provisional 94.13
PF07387308 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR0099 94.07
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 92.85
PTZ00296442 choline kinase; Provisional 92.74
PF05445434 Pox_ser-thr_kin: Poxvirus serine/threonine protein 92.72
PRK06148 1013 hypothetical protein; Provisional 92.31
PHA03111444 Ser/Thr kinase; Provisional 92.19
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information 
Probab=100.00  E-value=6e-50  Score=414.40  Aligned_cols=256  Identities=20%  Similarity=0.264  Sum_probs=224.8

Q ss_pred             CCCCeEEEeeeeeeCceEEEEEEEcCCCCCcCCCCceEEEEEEeecCCC-C------CCCCchHHHHHHHHhcCCCCCCe
Q 005214          139 NSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSK-G------CNYGPPYEWQVYNTLNGCYGIPG  211 (708)
Q Consensus       139 ~~~~Y~i~~~LG~G~fG~Vy~a~~~~~~~~~~~~~~~~vAiK~~~~~~~-~------~~~~~~~E~~il~~L~h~~~I~~  211 (708)
                      ..+.|.+.+.||+|+||.|-+|..+.+|        +.||||++++... +      ......+|++||+.|+||+ |+.
T Consensus       170 ~~d~yii~~~LGsGafg~Vkla~e~~tg--------k~vAiKIi~krk~~~~s~~~~~~~~v~~EieILkkL~HP~-IV~  240 (475)
T KOG0615|consen  170 FNDYYIISKTLGSGAFGLVKLAYEKKTG--------KQVAIKIINKRKSTGCSRAIAKTRDVQNEIEILKKLSHPN-IVR  240 (475)
T ss_pred             hcceeEeeeeecCCceeEEEEEEEcccC--------cEEEeeeeehhhcccccccccchhhhHHHHHHHHhcCCCC-EEE
Confidence            3446999999999999999999999999        8999999987632 1      1224579999999999987 899


Q ss_pred             eeeeeeeCCEEEEEEEcC-CCCHHHHHHhcCCCcCCCCCHHHHHHHHHHHHHHHHHHHHcCccccCCCCCCEEecCCCCC
Q 005214          212 VHYKGRQGDFYILVMDML-GPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTA  290 (708)
Q Consensus       212 ~~~~~~~~~~~~iV~e~~-ggsL~~~l~~~~~~~~~~ls~~~~~~i~~qll~gL~yLH~~gIvHrDIKP~NILl~~~~~~  290 (708)
                      ++++++..++.||||||+ ||+|++.+..++.     +.++.-+.+++|+|.||.|||++||+||||||+||||..+.  
T Consensus       241 ~~d~f~~~ds~YmVlE~v~GGeLfd~vv~nk~-----l~ed~~K~~f~Qll~avkYLH~~GI~HRDiKPeNILl~~~~--  313 (475)
T KOG0615|consen  241 IKDFFEVPDSSYMVLEYVEGGELFDKVVANKY-----LREDLGKLLFKQLLTAVKYLHSQGIIHRDIKPENILLSNDA--  313 (475)
T ss_pred             EeeeeecCCceEEEEEEecCccHHHHHHhccc-----cccchhHHHHHHHHHHHHHHHHcCcccccCCcceEEeccCC--
Confidence            999999999999999999 9999999999886     99999999999999999999999999999999999998763  


Q ss_pred             CCCcEEEeecCccccccCCCCCCcccccCCCcccccCccccchhhhcCCC---CCChhhHHHHHHHHHHHHhCCCCCCCC
Q 005214          291 DEKKLYLIDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRT---GSRRDDLESLAYTLIFLIKGRLPWQGY  367 (708)
Q Consensus       291 ~~~~vkL~DFGlA~~~~~~~~~~~~~~~~~~~~~~GT~~Y~APE~l~g~~---~s~~~DIwSlGvvL~eLltG~~Pf~~~  367 (708)
                      +...+||+|||+|+.....         ....++||||.|.|||++.+..   +..++|||||||+||-+|+|.+||.+.
T Consensus       314 e~~llKItDFGlAK~~g~~---------sfm~TlCGTpsYvAPEVl~~kg~~~~~~kVDiWSlGcvLfvcLsG~pPFS~~  384 (475)
T KOG0615|consen  314 EDCLLKITDFGLAKVSGEG---------SFMKTLCGTPSYVAPEVLASKGVEYYPSKVDIWSLGCVLFVCLSGYPPFSEE  384 (475)
T ss_pred             cceEEEecccchhhccccc---------eehhhhcCCccccChhheecCCeecccchheeeeccceEEEEeccCCCcccc
Confidence            3347999999999876533         2334799999999999999764   345899999999999999999999987


Q ss_pred             CCCc-HHHHHHHhhcCCChhhhccCCCHHHHHHHHHhhcCCCCCCccHHHHHHH
Q 005214          368 QGDN-KSFLVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISF  420 (708)
Q Consensus       368 ~~~~-~~~~i~~~~~~~~p~~l~~~~~~~~~~li~~~l~~dp~~RPs~~~ll~~  420 (708)
                      ..+. ....|.++++...|..+ ..++.+..+||+.||..||++||++.+++++
T Consensus       385 ~~~~sl~eQI~~G~y~f~p~~w-~~Iseea~dlI~~mL~VdP~~R~s~~eaL~h  437 (475)
T KOG0615|consen  385 YTDPSLKEQILKGRYAFGPLQW-DRISEEALDLINWMLVVDPENRPSADEALNH  437 (475)
T ss_pred             cCCccHHHHHhcCcccccChhh-hhhhHHHHHHHHHhhEeCcccCcCHHHHhcC
Confidence            7766 77888888888877665 5579999999999999999999999999986

>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>PTZ00384 choline kinase; Provisional Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>KOG1236 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PF07387 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR009973 This family consists of several Seadornavirus specific VP7 proteins of around 305 residues in length Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>PTZ00296 choline kinase; Provisional Back     alignment and domain information
>PF05445 Pox_ser-thr_kin: Poxvirus serine/threonine protein kinase; InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PHA03111 Ser/Thr kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query708
3sv0_A483 Crystal Structure Of Casein Kinase-1 Like Protein I 2e-52
3uys_A296 Crystal Structure Of Apo Human Ck1d Length = 296 1e-48
1ckj_A317 Casein Kinase I Delta Truncation Mutant Containing 1e-48
4hni_A296 Crystal Structure Of Ck1e In Complex With Pf4800567 2e-48
2csn_A297 Binary Complex Of Casein Kinase-1 With Cki7 Length 6e-47
1eh4_A298 Binary Complex Of Casein Kinase-1 From S. Pombe Wit 6e-47
2c47_A313 Structure Of Casein Kinase 1 Gamma 2 Length = 313 5e-44
4hgl_A330 Crystal Structure Of Ck1g3 With Compound 1 Length = 4e-42
2izr_A330 Structure Of Casein Kinase Gamma 3 In Complex With 1e-41
2chl_A351 Structure Of Casein Kinase 1 Gamma 3 Length = 351 1e-41
2cmw_A310 Structure Of Human Casein Kinase 1 Gamma-1 In Compl 8e-40
2kty_A368 Solution Structure Of Human Vaccinia Related Kinase 7e-21
2lav_A361 Nmr Solution Structure Of Human Vaccinia-Related Ki 7e-21
3op5_A364 Human Vaccinia-Related Kinase 1 Length = 364 4e-20
2v62_A345 Structure Of Vaccinia-Related Kinase 2 Length = 345 1e-18
2jii_A352 Structure Of Vaccinia Related Kinase 3 Length = 352 9e-15
4f99_A361 Human Cdc7 Kinase In Complex With Dbf4 And Nucleoti 5e-10
3g51_A325 Structural Diversity Of The Active Conformation Of 6e-07
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 6e-07
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 7e-07
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 1e-06
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 3e-06
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 3e-06
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 6e-06
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 7e-06
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 7e-06
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 8e-06
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 1e-05
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 1e-05
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 1e-05
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 2e-05
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 2e-05
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 3e-05
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 3e-05
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 4e-05
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 4e-05
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 4e-05
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 4e-05
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 4e-05
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 4e-05
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 4e-05
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 4e-05
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 5e-05
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 5e-05
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 5e-05
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 5e-05
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 5e-05
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 5e-05
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 5e-05
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-05
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 5e-05
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 6e-05
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 6e-05
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 6e-05
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 6e-05
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 8e-05
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 8e-05
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 8e-05
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 9e-05
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-04
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 1e-04
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-04
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 1e-04
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 1e-04
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-04
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 1e-04
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 1e-04
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 1e-04
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 2e-04
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-04
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-04
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 2e-04
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-04
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 2e-04
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 2e-04
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 2e-04
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 3e-04
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 3e-04
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 3e-04
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 3e-04
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 4e-04
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 4e-04
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 5e-04
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 5e-04
2pzi_A681 Crystal Structure Of Protein Kinase Pkng From Mycob 5e-04
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 5e-04
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 6e-04
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 6e-04
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 6e-04
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 6e-04
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 6e-04
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 6e-04
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 6e-04
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 7e-04
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 7e-04
4h58_A275 Braf In Complex With Compound 3 Length = 275 7e-04
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-04
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 8e-04
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 8e-04
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 8e-04
>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In Plant Length = 483 Back     alignment and structure 
Iteration: 1

 Score =  203 bits (517), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 173/294 (58%), Gaps = 24/294 (8%)
Query: 136 QVGNSPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPY 195
           +VGN   +++ RK+G G FG++Y+G               EVA+K E+  +K       Y
Sbjct: 4   RVGNK--FRLGRKIGSGSFGEIYLGTNIQTNE--------EVAIKLENVKTKHPQL--LY 51
Query: 196 EWQVYNTLNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDR-MSPNMAA 254
           E ++Y  L G  GIP V + G +GD+ +LVMD+LGPSL D++N      C R +S     
Sbjct: 52  ESKIYRILQGGTGIPNVRWFGVEGDYNVLVMDLLGPSLEDLFN-----FCSRKLSLKTVL 106
Query: 255 CIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQH 314
            +A + I+ +E +H K F+H D+KP+NFL+G    A++  +Y+ID GLA +++D S+ QH
Sbjct: 107 MLADQMINRVEFVHSKSFLHRDIKPDNFLMGLGRRANQ--VYIIDFGLAKKYRDTSTHQH 164
Query: 315 VEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSF 374
           + Y +  ++  GT RYASV+ HLG   SRRDDLESL Y L++ ++G LPWQG +   K  
Sbjct: 165 IPYRENKNL-TGTARYASVNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQ 223
Query: 375 ---LVCKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLI 425
               + +KK+ATS E +C   P  F  +     +++FD++P+Y+ L   F  L 
Sbjct: 224 KYEKISEKKVATSIEALCRGYPTEFASYFHYCRSLRFDDKPDYSYLKRLFRDLF 277
>pdb|3UYS|A Chain A, Crystal Structure Of Apo Human Ck1d Length = 296 Back     alignment and structure
>pdb|1CKJ|A Chain A, Casein Kinase I Delta Truncation Mutant Containing Residues 1-317 Complex With Bound Tungstate Length = 317 Back     alignment and structure
>pdb|4HNI|A Chain A, Crystal Structure Of Ck1e In Complex With Pf4800567 Length = 296 Back     alignment and structure
>pdb|2CSN|A Chain A, Binary Complex Of Casein Kinase-1 With Cki7 Length = 297 Back     alignment and structure
>pdb|1EH4|A Chain A, Binary Complex Of Casein Kinase-1 From S. Pombe With An Atp Competitive Inhibitor, Ic261 Length = 298 Back     alignment and structure
>pdb|2C47|A Chain A, Structure Of Casein Kinase 1 Gamma 2 Length = 313 Back     alignment and structure
>pdb|4HGL|A Chain A, Crystal Structure Of Ck1g3 With Compound 1 Length = 330 Back     alignment and structure
>pdb|2IZR|A Chain A, Structure Of Casein Kinase Gamma 3 In Complex With Inhibitor Length = 330 Back     alignment and structure
>pdb|2CHL|A Chain A, Structure Of Casein Kinase 1 Gamma 3 Length = 351 Back     alignment and structure
>pdb|2CMW|A Chain A, Structure Of Human Casein Kinase 1 Gamma-1 In Complex With 2-(2-Hydroxyethylamino)-6-(3-Chloroanilino)-9- Isopropylpurine (Casp Target) Length = 310 Back     alignment and structure
>pdb|2KTY|A Chain A, Solution Structure Of Human Vaccinia Related Kinase-1 Length = 368 Back     alignment and structure
>pdb|2LAV|A Chain A, Nmr Solution Structure Of Human Vaccinia-Related Kinase 1 Length = 361 Back     alignment and structure
>pdb|3OP5|A Chain A, Human Vaccinia-Related Kinase 1 Length = 364 Back     alignment and structure
>pdb|2V62|A Chain A, Structure Of Vaccinia-Related Kinase 2 Length = 345 Back     alignment and structure
>pdb|2JII|A Chain A, Structure Of Vaccinia Related Kinase 3 Length = 352 Back     alignment and structure
>pdb|4F99|A Chain A, Human Cdc7 Kinase In Complex With Dbf4 And Nucleotide Length = 361 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|2PZI|A Chain A, Crystal Structure Of Protein Kinase Pkng From Mycobacterium Tuberculosis In Complex With Tetrahydrobenzothiophene Ax20017 Length = 681 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query708
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 100.0
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 100.0
3uqc_A286 Probable conserved transmembrane protein; structur 100.0
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 100.0
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 100.0
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 100.0
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 100.0
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.97
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.92
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.89
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.84
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.7
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.36
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.2
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 99.06
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.94
3r70_A320 Aminoglycoside phosphotransferase; structural geno 98.55
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 98.45
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.38
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 98.31
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.26
3ats_A357 Putative uncharacterized protein; hypothetical pro 98.2
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.16
2q83_A346 YTAA protein; 2635576, structural genomics, joint 97.96
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 97.64
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 97.61
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 97.59
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.54
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 97.4
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 97.21
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 97.11
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 97.04
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 97.01
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 97.0
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 96.87
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 96.77
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 96.11
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 95.93
3mes_A424 Choline kinase; malaria, structural genomics, stru 95.91
3g15_A401 CK, chetk-alpha, choline kinase alpha; non-protein 94.56
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-54  Score=465.13  Aligned_cols=249  Identities=18%  Similarity=0.188  Sum_probs=216.7

Q ss_pred             CeEEEeeeeeeCceEEEEEEEcCCCCCcCCCCceEEEEEEeecCCCCCCCCchHHHHHHHHhcCCCCCCeeeeeeeeCCE
Q 005214          142 VYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQGDF  221 (708)
Q Consensus       142 ~Y~i~~~LG~G~fG~Vy~a~~~~~~~~~~~~~~~~vAiK~~~~~~~~~~~~~~~E~~il~~L~h~~~I~~~~~~~~~~~~  221 (708)
                      .|+++++||+|+||+||+|+++.+|        +.||||++..........+.+|+.+|+.|+|+| |+.+++++.+++.
T Consensus        75 ~y~~~~~iG~G~fG~V~~a~~~~tg--------~~vAiK~i~~~~~~~~~~~~~Ei~il~~l~Hpn-IV~l~~~~~~~~~  145 (346)
T 4fih_A           75 YLDNFIKIGEGSTGIVCIATVRSSG--------KLVAVKKMDLRKQQRRELLFNEVVIMRDYQHEN-VVEMYNSYLVGDE  145 (346)
T ss_dssp             TEEEEEEEEECSSCEEEEEEETTTC--------CEEEEEEEEGGGCSSGGGGHHHHHHHHHCCCTT-BCCEEEEEEETTE
T ss_pred             hcEEeEEeecCcCeEEEEEEECCCC--------CEEEEEEEecCchhHHHHHHHHHHHHHhCCCCC-CCcEEEEEEECCE
Confidence            5999999999999999999999998        799999998776666667899999999999876 8889999999999


Q ss_pred             EEEEEEcC-CCCHHHHHHhcCCCcCCCCCHHHHHHHHHHHHHHHHHHHHcCccccCCCCCCEEecCCCCCCCCcEEEeec
Q 005214          222 YILVMDML-GPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDL  300 (708)
Q Consensus       222 ~~iV~e~~-ggsL~~~l~~~~~~~~~~ls~~~~~~i~~qll~gL~yLH~~gIvHrDIKP~NILl~~~~~~~~~~vkL~DF  300 (708)
                      +||||||| ||+|.+++....      +++.+++.|+.||+.||+|||++|||||||||+||||+.++     .+||+||
T Consensus       146 ~~ivmEy~~gg~L~~~l~~~~------l~e~~~~~~~~qi~~aL~ylH~~~IiHRDlKp~NILl~~~g-----~vKl~DF  214 (346)
T 4fih_A          146 LWVVMEFLEGGALTDIVTHTR------MNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDG-----RVKLSDF  214 (346)
T ss_dssp             EEEEECCCTTEEHHHHHHHSC------CCHHHHHHHHHHHHHHHHHHHHTTEECCCCSGGGEEECTTC-----CEEECCC
T ss_pred             EEEEEeCCCCCcHHHHHHcCC------CCHHHHHHHHHHHHHHHHHHHHCCcccccCCHHHEEECCCC-----CEEEecC
Confidence            99999999 999999997632      99999999999999999999999999999999999999888     5999999


Q ss_pred             CccccccCCCCCCcccccCCCcccccCccccchhhhcCCCCCChhhHHHHHHHHHHHHhCCCCCCCCCCCcHHHHHHHhh
Q 005214          301 GLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLVCKKK  380 (708)
Q Consensus       301 GlA~~~~~~~~~~~~~~~~~~~~~~GT~~Y~APE~l~g~~~s~~~DIwSlGvvL~eLltG~~Pf~~~~~~~~~~~i~~~~  380 (708)
                      |+|+.+......        ..+++||+.|||||++.+..|+.++|||||||+||||++|++||.+.+..+....+....
T Consensus       215 Gla~~~~~~~~~--------~~~~~GTp~YmAPEvl~~~~y~~~~DiWSlGvilyeml~G~~PF~~~~~~~~~~~i~~~~  286 (346)
T 4fih_A          215 GFCAQVSKEVPR--------RKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNL  286 (346)
T ss_dssp             TTCEECCSSSCC--------BCCCCSCGGGCCHHHHTTCCBCTHHHHHHHHHHHHHHHHSSCTTTTSCHHHHHHHHHHSS
T ss_pred             cCceecCCCCCc--------ccccccCcCcCCHHHHCCCCCCcHHHHHHHHHHHHHHHHCCCCCCCcCHHHHHHHHHcCC
Confidence            999887654221        236899999999999999999999999999999999999999998866555444444322


Q ss_pred             cCCChhhhccCCCHHHHHHHHHhhcCCCCCCccHHHHHHH
Q 005214          381 MATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISF  420 (708)
Q Consensus       381 ~~~~p~~l~~~~~~~~~~li~~~l~~dp~~RPs~~~ll~~  420 (708)
                      ..  .......+++++++||.+||..||++||++++++++
T Consensus       287 ~~--~~~~~~~~s~~~~dli~~~L~~dP~~R~ta~e~l~H  324 (346)
T 4fih_A          287 PP--RLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKH  324 (346)
T ss_dssp             CC--CCSCGGGSCHHHHHHHHHHSCSSTTTSCCHHHHTTC
T ss_pred             CC--CCCccccCCHHHHHHHHHHcCCChhHCcCHHHHhcC
Confidence            11  112234689999999999999999999999999875
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 708
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-54
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-43
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 4e-25
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-24
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 9e-24
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-23
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-23
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-23
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 3e-23
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 4e-23
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-23
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 6e-23
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 8e-23
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-22
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-22
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-22
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-22
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 5e-22
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 7e-22
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 9e-22
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-21
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-21
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-21
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 4e-21
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 5e-21
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 9e-21
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 9e-21
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 1e-20
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-20
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-20
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-20
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-20
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-20
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-20
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 5e-20
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 6e-20
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 8e-20
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 9e-20
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-19
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-19
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-19
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-19
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 5e-19
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 6e-19
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 1e-18
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 3e-18
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 5e-18
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 6e-18
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 7e-18
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 7e-18
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 9e-18
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-17
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 2e-17
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 5e-17
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 6e-17
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 7e-17
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-16
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 7e-16
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-15
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 6e-15
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-14
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-13
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 5e-12
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Casein kinase-1, CK1
species: Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]

 Score =  187 bits (475), Expect = 1e-54
 Identities = 96/287 (33%), Positives = 160/287 (55%), Gaps = 18/287 (6%)

Query: 143 YKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNSKGCNYGPPYEWQVYNT 202
           YK+ R++G+G FG ++ G               +VA+KFE R S         E++ Y  
Sbjct: 7   YKVGRRIGEGSFGVIFEGTNLLNNQ--------QVAIKFEPRRSDAPQL--RDEYRTYKL 56

Query: 203 LNGCYGIPGVHYKGRQGDFYILVMDMLGPSLWDVWNSLGQSICDRMSPNMAACIAVEAIS 262
           L GC GIP V+Y G++G   +LV+D+LGPSL D+ +  G+    + S    A  A + ++
Sbjct: 57  LAGCTGIPNVYYFGQEGLHNVLVIDLLGPSLEDLLDLCGR----KFSVKTVAMAAKQMLA 112

Query: 263 ILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYLIDLGLASRWKDASSGQHVEYDQRPD 322
            ++ +H K  V+ D+KP+NFL+G+P + +   +Y++D G+   ++D  + QH+ Y ++ +
Sbjct: 113 RVQSIHEKSLVYRDIKPDNFLIGRPNSKNANMIYVVDFGMVKFYRDPVTKQHIPYREKKN 172

Query: 323 VFRGTIRYASVHAHLGRTGSRRDDLESLAYTLIFLIKGRLPWQGYQGDN---KSFLVCKK 379
              GT RY S++ HLGR  SRRDDLE+L +  ++ ++G LPWQG +      K   + +K
Sbjct: 173 -LSGTARYMSINTHLGREQSRRDDLEALGHVFMYFLRGSLPWQGLKAATNKQKYERIGEK 231

Query: 380 KMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISFFDSLIE 426
           K +T    +C   P  F +++    N+ FD  P+Y  L   F  ++E
Sbjct: 232 KQSTPLRELCAGFPEEFYKYMHYARNLAFDATPDYDYLQGLFSKVLE 278
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query708
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.9
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.5
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.95
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.85
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 96.79
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 96.38
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 95.74
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Cell cycle checkpoint kinase chk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.3e-52  Score=433.70  Aligned_cols=254  Identities=20%  Similarity=0.215  Sum_probs=211.9

Q ss_pred             CCCeEEEeeeeeeCceEEEEEEEcCCCCCcCCCCceEEEEEEeecCC-CCCCCCchHHHHHHHHhcCCCCCCeeeeeeee
Q 005214          140 SPVYKIERKLGKGGFGQVYVGRRAHGGSDRIGPDAIEVALKFEHRNS-KGCNYGPPYEWQVYNTLNGCYGIPGVHYKGRQ  218 (708)
Q Consensus       140 ~~~Y~i~~~LG~G~fG~Vy~a~~~~~~~~~~~~~~~~vAiK~~~~~~-~~~~~~~~~E~~il~~L~h~~~I~~~~~~~~~  218 (708)
                      .++|+++++||+|+||+||+|+++.++        +.||||++.... ......+.+|+.+|+.|+|+| |+.++.++.+
T Consensus         4 ~~dy~~~~~lG~G~fg~V~~~~~~~~~--------~~vAiK~i~~~~~~~~~~~~~~Ei~~l~~l~Hpn-Iv~~~~~~~~   74 (271)
T d1nvra_           4 VEDWDLVQTLGEGAYGEVQLAVNRVTE--------EAVAVKIVDMKRAVDCPENIKKEICINKMLNHEN-VVKFYGHRRE   74 (271)
T ss_dssp             TTEEEEEEEEEEETTEEEEEEEETTTC--------CEEEEEEEECC-------CHHHHHHHHHTCCCTT-BCCEEEEEEE
T ss_pred             CcceEEEEEEecCcCeEEEEEEECCCC--------CEEEEEEEehhhcchHHHHHHHHHHHHHhCCCCC-EeeEeeeecc
Confidence            347999999999999999999999988        799999987653 334467899999999999877 8889999999


Q ss_pred             CCEEEEEEEcC-CCCHHHHHHhcCCCcCCCCCHHHHHHHHHHHHHHHHHHHHcCccccCCCCCCEEecCCCCCCCCcEEE
Q 005214          219 GDFYILVMDML-GPSLWDVWNSLGQSICDRMSPNMAACIAVEAISILEKLHLKGFVHGDVKPENFLLGQPGTADEKKLYL  297 (708)
Q Consensus       219 ~~~~~iV~e~~-ggsL~~~l~~~~~~~~~~ls~~~~~~i~~qll~gL~yLH~~gIvHrDIKP~NILl~~~~~~~~~~vkL  297 (708)
                      ++.+||||||+ ||+|.+++...+.     +++.+++.++.||+.||+|||++|||||||||+||||+.++     .+||
T Consensus        75 ~~~~~ivmEy~~gg~L~~~l~~~~~-----l~e~~~~~i~~qi~~al~ylH~~~IiHrDiKp~NILl~~~~-----~~KL  144 (271)
T d1nvra_          75 GNIQYLFLEYCSGGELFDRIEPDIG-----MPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERD-----NLKI  144 (271)
T ss_dssp             TTEEEEEEECCTTEEGGGGSBTTTB-----CCHHHHHHHHHHHHHHHHHHHHTTEECSCCCGGGEEECTTC-----CEEE
T ss_pred             CceeEEEEeccCCCcHHHHHhcCCC-----CCHHHHHHHHHHHHHHHHHHHHcCCccCcccHHHEEECCCC-----CEEE
Confidence            99999999999 8899999976554     99999999999999999999999999999999999999887     5999


Q ss_pred             eecCccccccCCCCCCcccccCCCcccccCccccchhhhcCCCC-CChhhHHHHHHHHHHHHhCCCCCCCCCCCcHHHHH
Q 005214          298 IDLGLASRWKDASSGQHVEYDQRPDVFRGTIRYASVHAHLGRTG-SRRDDLESLAYTLIFLIKGRLPWQGYQGDNKSFLV  376 (708)
Q Consensus       298 ~DFGlA~~~~~~~~~~~~~~~~~~~~~~GT~~Y~APE~l~g~~~-s~~~DIwSlGvvL~eLltG~~Pf~~~~~~~~~~~i  376 (708)
                      +|||+|+.+......      ......+||+.|||||++.+..+ +.++|||||||+||||++|+.||............
T Consensus       145 ~DFG~a~~~~~~~~~------~~~~~~~GT~~Y~APE~~~~~~~~~~~~DiwSlGvilyeml~G~~pf~~~~~~~~~~~~  218 (271)
T d1nvra_         145 SDFGLATVFRYNNRE------RLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSD  218 (271)
T ss_dssp             CCCTTCEECEETTEE------CCBCCCCSCGGGSCTHHHHCSSBCHHHHHHHHHHHHHHHHHHSSCSCSSSSTTSHHHHH
T ss_pred             ccchhheeeccCCcc------ccccceeeCcCccCHhHhcCCCCCCCceeeeHhHHHHHHHHhCCCCCCCCChHHHHHHH
Confidence            999999877543221      11235789999999999999876 57899999999999999999999886665554444


Q ss_pred             HHhhcCCChhhhccCCCHHHHHHHHHhhcCCCCCCccHHHHHHH
Q 005214          377 CKKKMATSPELMCCFCPAPFKQFLEAVTNMKFDEEPNYAKLISF  420 (708)
Q Consensus       377 ~~~~~~~~p~~l~~~~~~~~~~li~~~l~~dp~~RPs~~~ll~~  420 (708)
                      .......  ......+++++.+|+.+||+.||++||++++++++
T Consensus       219 ~~~~~~~--~~~~~~~s~~~~~li~~~L~~dP~~R~t~~eil~h  260 (271)
T d1nvra_         219 WKEKKTY--LNPWKKIDSAPLALLHKILVENPSARITIPDIKKD  260 (271)
T ss_dssp             HHTTCTT--STTGGGSCHHHHHHHHHHSCSSTTTSCCHHHHTTC
T ss_pred             HhcCCCC--CCccccCCHHHHHHHHHHcCCChhHCcCHHHHhcC
Confidence            3333222  12234578999999999999999999999998774
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure