BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 005230
         (707 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3B8L|A Chain A, Crystal Structure Of A Putative Aromatic Ring Hydroxylase
           (Saro_3538) From Novosphingobium Aromaticivorans Dsm At
           1.75 A Resolution
 pdb|3B8L|B Chain B, Crystal Structure Of A Putative Aromatic Ring Hydroxylase
           (Saro_3538) From Novosphingobium Aromaticivorans Dsm At
           1.75 A Resolution
 pdb|3B8L|C Chain C, Crystal Structure Of A Putative Aromatic Ring Hydroxylase
           (Saro_3538) From Novosphingobium Aromaticivorans Dsm At
           1.75 A Resolution
 pdb|3B8L|D Chain D, Crystal Structure Of A Putative Aromatic Ring Hydroxylase
           (Saro_3538) From Novosphingobium Aromaticivorans Dsm At
           1.75 A Resolution
 pdb|3B8L|E Chain E, Crystal Structure Of A Putative Aromatic Ring Hydroxylase
           (Saro_3538) From Novosphingobium Aromaticivorans Dsm At
           1.75 A Resolution
 pdb|3B8L|F Chain F, Crystal Structure Of A Putative Aromatic Ring Hydroxylase
           (Saro_3538) From Novosphingobium Aromaticivorans Dsm At
           1.75 A Resolution
          Length = 163

 Score = 29.3 bits (64), Expect = 6.9,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 360 CNTDDLLCVQIRNVSPAHAPDIVLYIDAITIVFEE 394
           C  +D L +Q   ++ AHA D V  IDA+  VF E
Sbjct: 22  CPIEDRLAIQDLXIAYAHAVDTVSDIDAVLDVFTE 56


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.130    0.374 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,465,059
Number of Sequences: 62578
Number of extensions: 772705
Number of successful extensions: 1431
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1430
Number of HSP's gapped (non-prelim): 2
length of query: 707
length of database: 14,973,337
effective HSP length: 106
effective length of query: 601
effective length of database: 8,340,069
effective search space: 5012381469
effective search space used: 5012381469
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 55 (25.8 bits)