BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 005242
         (706 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1YT8|A Chain A, Crystal Structure Of Thiosulfate Sulfurtransferase From
           Pseudomonas Aeruginosa
          Length = 539

 Score = 29.3 bits (64), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 175 PRDGTPALLIQDDGGGMDPEAMRRCMSFGFSDKKSKSVIGQYGNGFKTSSMRLGADVIVF 234
           PR  TP + + DDG G+ P A +R    G+SD    +++    +G++ +   L  DV V 
Sbjct: 60  PRRDTP-ITVYDDGEGLAPVAAQRLHDLGYSD---VALLDGGLSGWRNAGGELFRDVNVP 115

Query: 235 SRHLND 240
           S+   +
Sbjct: 116 SKAFGE 121


>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State
 pdb|2DFS|M Chain M, 3-D Structure Of Myosin-V Inhibited State
          Length = 1080

 Score = 28.9 bits (63), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 657 KLRAKCLE-YEKRRVELDQKVTQLKSELGEYNCEYERLMAELKALD 701
           K+ A+ +E Y+K  + L+ K+ QL+ ++ E N EY+ L+ ++  L+
Sbjct: 910 KIEARSVERYKKLHIGLENKIMQLQRKIDEQNKEYKSLLEKMNNLE 955


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.134    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,777,922
Number of Sequences: 62578
Number of extensions: 931904
Number of successful extensions: 2102
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 2101
Number of HSP's gapped (non-prelim): 8
length of query: 706
length of database: 14,973,337
effective HSP length: 106
effective length of query: 600
effective length of database: 8,340,069
effective search space: 5004041400
effective search space used: 5004041400
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)