BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 005245
(706 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4DZ4|A Chain A, X-Ray Crystal Structure Of A Hypothetical Agmatinase From
Burkholderia Thailandensis
pdb|4DZ4|B Chain B, X-Ray Crystal Structure Of A Hypothetical Agmatinase From
Burkholderia Thailandensis
pdb|4DZ4|C Chain C, X-Ray Crystal Structure Of A Hypothetical Agmatinase From
Burkholderia Thailandensis
pdb|4DZ4|D Chain D, X-Ray Crystal Structure Of A Hypothetical Agmatinase From
Burkholderia Thailandensis
pdb|4DZ4|E Chain E, X-Ray Crystal Structure Of A Hypothetical Agmatinase From
Burkholderia Thailandensis
pdb|4DZ4|F Chain F, X-Ray Crystal Structure Of A Hypothetical Agmatinase From
Burkholderia Thailandensis
Length = 324
Score = 32.3 bits (72), Expect = 0.97, Method: Compositional matrix adjust.
Identities = 12/37 (32%), Positives = 18/37 (48%)
Query: 397 PWTEAKEHKFEALQYMMPWFSVHHPSAIDPAVIRYAK 433
PW + Y WF HHP +I PA++ +A+
Sbjct: 87 PWGFDPFDDLAVIDYGDCWFDAHHPLSIKPAIVEHAR 123
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.135 0.419
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,140,957
Number of Sequences: 62578
Number of extensions: 795069
Number of successful extensions: 1522
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1521
Number of HSP's gapped (non-prelim): 1
length of query: 706
length of database: 14,973,337
effective HSP length: 106
effective length of query: 600
effective length of database: 8,340,069
effective search space: 5004041400
effective search space used: 5004041400
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)