Query         005258
Match_columns 705
No_of_seqs    49 out of 51
Neff          2.7 
Searched_HMMs 46136
Date          Thu Mar 28 20:37:17 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/005258.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/005258hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07891 DUF1666:  Protein of u 100.0  7E-118  2E-122  882.2  20.2  247  457-705     1-247 (247)
  2 PF06956 RtcR:  Regulator of RN  24.8 1.1E+02  0.0023   31.6   4.4   21  494-514   160-180 (183)
  3 PF10706 Aminoglyc_resit:  Amin  12.7      65  0.0014   32.8  -0.1   14  469-482   122-135 (174)
  4 PF11406 Tachystatin_A:  Antimi  11.2      88  0.0019   25.3   0.1    9  342-350    13-21  (44)
  5 KOG3970 Predicted E3 ubiquitin  10.3 1.8E+02   0.004   31.2   2.2   28  327-354   110-141 (299)
  6 PF14829 GPAT_N:  Glycerol-3-ph   9.2 1.8E+02  0.0039   26.5   1.4   24  466-490    29-52  (77)
  7 PF06141 Phage_tail_U:  Phage m   8.9 1.5E+02  0.0033   29.0   0.9   36  329-364     9-49  (133)
  8 PF02937 COX6C:  Cytochrome c o   8.7 2.6E+02  0.0056   24.8   2.1   25  387-411    46-71  (73)
  9 PF00489 IL6:  Interleukin-6/G-   8.6 2.3E+02  0.0049   27.7   1.9   23  494-517    54-76  (154)
 10 KOG1329 Phospholipase D1 [Lipi   8.3   1E+02  0.0022   37.9  -0.6   11  473-483   646-656 (887)

No 1  
>PF07891 DUF1666:  Protein of unknown function (DUF1666);  InterPro: IPR012870 These sequences are derived from hypothetical plant proteins of unknown function. The region in question is approximately 250 residues long. 
Probab=100.00  E-value=7e-118  Score=882.19  Aligned_cols=247  Identities=62%  Similarity=1.032  Sum_probs=239.2

Q ss_pred             hhhhhhhhhHHHHHHHHHHhhhHHhhHHhhhcCCCCCCCchhhHhhhhhhHHHHHHhhhcCCCCCCchhHHHhhhhcccc
Q 005258          457 HSDLEVVYVGQLCLSWEILHWQYEKSLELWESDPYGICRYNEVAGEFQQFQVLMQRFIENEPFEGPRVENYIKNRCVLRN  536 (705)
Q Consensus       457 y~DLE~vYVaQiCLSWEaL~WqY~k~~~l~~sd~~~~~~Yn~VAqEFQQFQVLLQRFIENEPFqG~RvE~YaR~R~~l~k  536 (705)
                      |+|||+|||||||||||||||||++|++++++||++++|||+|||+|||||||||||||||||+||||||||||||++||
T Consensus         1 y~dLE~vYVaQiCLSWEaL~wqY~k~~~l~~~~~~~~~~yn~VA~eFQqFQVLLQRFiENEPfeG~R~e~YaR~R~~~~k   80 (247)
T PF07891_consen    1 YSDLETVYVAQICLSWEALHWQYKKASELWESDPQNPHCYNHVAGEFQQFQVLLQRFIENEPFEGPRVENYARNRCSLPK   80 (247)
T ss_pred             CcchHHHHHHHHHhhHHHHHhHHHHHHHHHhcCCCCCCChHHHHHHHHHHHHHHHHHHhCCCCCCccHHHHHHHHHhhHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccceeccchhHHHHhhhccCCCccCHHHHHHHHHHHHHHHHHHHhhcccchhhhhhcccCcCCCCCChhhhHHHHHH
Q 005258          537 LLQVPVIREDSKKDKKARMKMKDEYAITSDMLVEIMEESIRIFWRFVRVDKDANIMIQKSRKGTQIEPQDALDLGLLAEV  616 (705)
Q Consensus       537 LLQVP~ir~d~~~Dkk~~~~~~~~~~Iss~~ll~IiEesIrtFw~FLkaDK~k~~~i~k~~~~~~~~~qDp~d~~Ll~~V  616 (705)
                      |||||+||+|+.+||+..++++.+++|+|++|++||||||+|||+||||||+++|+++|+..++++.  ||+|++||++|
T Consensus        81 LLqVP~ir~d~~~dkk~~~~~~~~~~I~s~~l~~IiEesI~tFw~FlkaDK~k~~~~~k~~~~~~~~--d~~d~~ll~~i  158 (247)
T PF07891_consen   81 LLQVPEIREDSEKDKKDMREEEKDSAISSDMLLEIIEESIRTFWEFLKADKDKPNQILKGFFGTQVE--DPVDPELLQDI  158 (247)
T ss_pred             HhcCCccccchhhhhhhhhhccccceecHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHhcCCCC--CccchHHHHHH
Confidence            9999999999888888644445566999999999999999999999999999999999999999875  99999999999


Q ss_pred             HHHhHHHHHHHHHhhhcCcceeecccccccchhhhhhhhhhhhhhhhhhhhcCCCCChhHHhHHHhhcccccccCCceee
Q 005258          617 RTSLQKKEKKLKEILRSGNCILRKFQKQQENSDQVLYFFSQVDMKLVARVLNMTKLTTDQLLWCRNKLDKINFISRRIHV  696 (705)
Q Consensus       617 ~t~LqKKe~KLKDl~Rs~kCi~KK~~k~~eE~~q~l~lfalIDlKLVSRVLrMs~lt~eQL~WCeEKm~KI~~~~gKl~r  696 (705)
                      +++||||++|||||+|+||||+||+||++++++++.+|||+|||||||||||||+||+||||||+|||+||+|++|||||
T Consensus       159 k~~lqKKe~kLKdl~r~~~ci~kk~~k~~e~~~~~~~lf~~IdlKlVsRVLrMs~lt~eQL~WCeeKm~ki~~~~~Kl~r  238 (247)
T PF07891_consen  159 KKSLQKKEKKLKDLLRSGKCIRKKFQKHEEDREEVELLFALIDLKLVSRVLRMSKLTKEQLHWCEEKMSKINFVDGKLQR  238 (247)
T ss_pred             HHHHHHHHHHHHHHhccccchhhhhccccchhhHHHHHHHHHHHHHHHHHhchhhhhHHHHHHHHHHHHhcCcccCceee
Confidence            99999999999999999999999999999988889999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCC
Q 005258          697 EPAFLLFPC  705 (705)
Q Consensus       697 dpSplLFPc  705 (705)
                      ||||+||||
T Consensus       239 d~S~llFPc  247 (247)
T PF07891_consen  239 DPSPLLFPC  247 (247)
T ss_pred             cCCCCCCCC
Confidence            999999999


No 2  
>PF06956 RtcR:  Regulator of RNA terminal phosphate cyclase;  InterPro: IPR009715 RtcR is a sigma54-dependent enhancer binding protein [] that activates transcription of the rtcBA operon. The product of the rtcA gene is an RNA 3 -terminal phosphate cyclase []. This domain is found at the N terminus of the RtcR sequence. RtcR, and other sigma54-dependent activators, contain IPR002078 from INTERPRO in the central region of the protein sequence.
Probab=24.77  E-value=1.1e+02  Score=31.56  Aligned_cols=21  Identities=33%  Similarity=0.517  Sum_probs=17.3

Q ss_pred             CCchhhHhhhhhhHHHHHHhh
Q 005258          494 CRYNEVAGEFQQFQVLMQRFI  514 (705)
Q Consensus       494 ~~Yn~VAqEFQQFQVLLQRFI  514 (705)
                      .+|+.+|+.|++=|.==..|+
T Consensus       160 srYd~ia~Rf~~~~~e~~~fL  180 (183)
T PF06956_consen  160 SRYDAIASRFAQEQQEAVSFL  180 (183)
T ss_pred             cchHHHHHHHHHHHHHHHHHh
Confidence            689999999999887666665


No 3  
>PF10706 Aminoglyc_resit:  Aminoglycoside-2''-adenylyltransferase;  InterPro: IPR019646  Aminoglycoside-2''-adenylyltransferase is conserved in Bacteria. It confers resistance to kanamycin, gentamicin, and tobramycin []. The protein is also produced by plasmids in various bacterial species and confers resistance to essentially all clinically available aminoglycosides except streptomycin, and it eliminates the synergism between aminoglycosides and cell-wall active agents []. ; PDB: 4E8I_A 4E8J_B.
Probab=12.75  E-value=65  Score=32.81  Aligned_cols=14  Identities=29%  Similarity=0.477  Sum_probs=5.9

Q ss_pred             HHHHHHHhhhHHhh
Q 005258          469 CLSWEILHWQYEKS  482 (705)
Q Consensus       469 CLSWEaL~WqY~k~  482 (705)
                      |+||||..|-|.--
T Consensus       122 CiS~Ea~lf~~~y~  135 (174)
T PF10706_consen  122 CISAEAQLFHYGYY  135 (174)
T ss_dssp             EE-HHHH-------
T ss_pred             CCCHHHHhhhcccc
Confidence            99999999998653


No 4  
>PF11406 Tachystatin_A:  Antimicrobial peptide tachystatin A;  InterPro: IPR022717  Tachystatin A contains a cysteine-stabilised triple-stranded beta-sheet and shows features common to membrane-interactive peptides. Tachystatin A is thought to have an antimicrobial activity similar to defensins.Tachystatin A is also a chitin-binding peptide []. ; PDB: 1CIX_A.
Probab=11.17  E-value=88  Score=25.31  Aligned_cols=9  Identities=67%  Similarity=1.106  Sum_probs=4.4

Q ss_pred             hhhcCCcee
Q 005258          342 ARAIGLPTI  350 (705)
Q Consensus       342 ~R~~gl~ti  350 (705)
                      ||.-|||||
T Consensus        13 vrsyglpti   21 (44)
T PF11406_consen   13 VRSYGLPTI   21 (44)
T ss_dssp             S--TTS-S-
T ss_pred             EEccCCCCc
Confidence            688899998


No 5  
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=10.32  E-value=1.8e+02  Score=31.24  Aligned_cols=28  Identities=32%  Similarity=0.442  Sum_probs=21.9

Q ss_pred             chHHHHHHHHHHHHHh---hhc-CCceecccC
Q 005258          327 EHQDLIDQLKTELKKA---RAI-GLPTILEES  354 (705)
Q Consensus       327 ehqdlieqlK~elk~~---R~~-gl~tilee~  354 (705)
                      +-.-+++.||..||.|   |++ |||+|-|+.
T Consensus       110 lvsPva~aLre~L~qvNWaRagLGLpll~E~~  141 (299)
T KOG3970|consen  110 LVSPVAEALREQLKQVNWARAGLGLPLLPELN  141 (299)
T ss_pred             ccchhHHHHHHHHHhhhHHhhccCCccchhhc
Confidence            3456788888888875   787 999998764


No 6  
>PF14829 GPAT_N:  Glycerol-3-phosphate acyltransferase N-terminal; PDB: 1IUQ_A 1K30_A.
Probab=9.19  E-value=1.8e+02  Score=26.45  Aligned_cols=24  Identities=25%  Similarity=0.408  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHhhhHHhhHHhhhcCC
Q 005258          466 GQLCLSWEILHWQYEKSLELWESDP  490 (705)
Q Consensus       466 aQiCLSWEaL~WqY~k~~~l~~sd~  490 (705)
                      +++---||-|+|||++|- +.+.+|
T Consensus        29 ~~va~gmeelY~NYk~AV-l~Sg~p   52 (77)
T PF14829_consen   29 ANVAAGMEELYQNYKNAV-LQSGDP   52 (77)
T ss_dssp             HHHHHHHHHHHHHHHHHH-HHTT-T
T ss_pred             hhHHHHHHHHHHHHHHHH-HhCCCC
Confidence            345567999999999975 234444


No 7  
>PF06141 Phage_tail_U:  Phage minor tail protein U;  InterPro: IPR009312 This entry is represented by Bacteriophage lambda, GpU, a minor tail protein. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  This entry represents a tail fibre component U of bacteriophage.; PDB: 3FZ2_D 3FZB_J 1Z1Z_A.
Probab=8.87  E-value=1.5e+02  Score=28.95  Aligned_cols=36  Identities=25%  Similarity=0.530  Sum_probs=23.3

Q ss_pred             HHHHHHHHHHHHHhhh--cCCceecccCCCccc---cccCC
Q 005258          329 QDLIDQLKTELKKARA--IGLPTILEESESPKI---TEDLK  364 (705)
Q Consensus       329 qdlieqlK~elk~~R~--~gl~tilee~Espk~---~edlk  364 (705)
                      +.+|+.||..+.....  .|+|+.+.++|.|-|   ..|..
T Consensus         9 ~aVld~L~~~~~~~~~~fdGrP~fide~elPAVaV~l~Da~   49 (133)
T PF06141_consen    9 KAVLDALKANIPEIVTFFDGRPAFIDEEELPAVAVYLDDAE   49 (133)
T ss_dssp             HHHHHHHHHH-STSSEEEES--SSS-GGGSSEEEEEEEEEE
T ss_pred             HHHHHHHHhcCCCCeEEECCcccccccccCceEEEEeccCc
Confidence            4577778877765443  499999999999987   45555


No 8  
>PF02937 COX6C:  Cytochrome c oxidase subunit VIc;  InterPro: IPR004204 Cytochrome c oxidase, a 13 subunit complex, 1.9.3.1 from EC is the terminal oxidase in the mitochondrial electron transport chain. This family is composed of cytochrome c oxidase subunit VIc.; GO: 0004129 cytochrome-c oxidase activity; PDB: 3AG4_I 2DYS_V 3ASO_I 2EIK_V 2EIM_I 1OCC_V 1V54_V 1OCO_V 3ASN_V 2EIL_I ....
Probab=8.75  E-value=2.6e+02  Score=24.82  Aligned_cols=25  Identities=24%  Similarity=0.635  Sum_probs=12.9

Q ss_pred             HHHHHHhhhhhh-hhhhhhccccccC
Q 005258          387 SYRERMRKFDIL-NYQKMYTIGFLQS  411 (705)
Q Consensus       387 kY~ERMrkfDiL-n~Qkl~aig~lqs  411 (705)
                      +|+|=.+.+|.+ .+..|...|++||
T Consensus        46 ~YadFYknYD~~k~fe~M~~~G~fqS   71 (73)
T PF02937_consen   46 AYADFYKNYDPMKDFEEMRKAGIFQS   71 (73)
T ss_dssp             HHHHHHHT--HHHHHHHHHHTT--SS
T ss_pred             HHHHHHHccChHHHHHHHHhcCCccc
Confidence            455555555555 2455778888876


No 9  
>PF00489 IL6:  Interleukin-6/G-CSF/MGF family;  InterPro: IPR003573 Interleukin-6 (IL6), also refered to as B-cell stimulatory factor-2 (BSF-2) and interferon beta-2, is a cytokine involved in a wide variety of biological functions []. It plays an essential role in the final differentiation of B-cells into IG-secreting cells, as well as inducing myeloma/plasmacytoma growth, nerve cell differentiation and, in hepatocytes, acute phase reactants [, ]. A number of other cytokines may be grouped with IL6 on the basis of sequence similarity [, , ]: these include granulocyte colony-stimulating factor (GCSF) and myelomonocytic growth factor (MGF). GCSF acts in hematopoiesis by affecting the production, differentiation and function of 2 related white cell groups in the blood []. MGF also acts in hematopoiesis, stimulating proliferation and colony formation of normal and transformed avian cells of the myeloid lineage. Cytokines of the IL6/GCSF/MGF family are glycoproteins of about 170 to 180 amino acid residues that contains four conserved cysteine residues involved in two disulphide bonds []. They have a compact, globular fold (similar to other interleukins), stabilised by the 2 disulphide bonds. One half of the structure is dominated by a 4 alpha-helix bundle with a left-handed twist []: the helices are anti-parallel, with 2 overhand connections, which fall into a 2-stranded anti-parallel beta-sheet. The fourth alpha-helix is important to the biological activity of the molecule []. It has been said [] that this family can be extended by the adjunction of LIF and OSM (see the relevant entry IPR001581 from INTERPRO) which seem to be structurally related.; GO: 0005125 cytokine activity, 0006955 immune response, 0005576 extracellular region; PDB: 1P9M_B 2IL6_A 1IL6_A 1ALU_A 3QWR_B 3DUH_C 3D85_C 3D87_C 1BGC_A 2L3Y_A ....
Probab=8.55  E-value=2.3e+02  Score=27.70  Aligned_cols=23  Identities=17%  Similarity=0.576  Sum_probs=19.7

Q ss_pred             CCchhhHhhhhhhHHHHHHhhhcC
Q 005258          494 CRYNEVAGEFQQFQVLMQRFIENE  517 (705)
Q Consensus       494 ~~Yn~VAqEFQQFQVLLQRFIENE  517 (705)
                      .|-..++.-.|-||++|+ ||+++
T Consensus        54 ~CL~ri~~GL~~yq~lL~-~l~~~   76 (154)
T PF00489_consen   54 TCLSRIHSGLQEYQILLK-YLQGE   76 (154)
T ss_dssp             HHHHHHHHHHHHHHHHHH-HTTTS
T ss_pred             HHHHHHHHHHHHHHHHHH-HHHhh
Confidence            377889999999999997 78775


No 10 
>KOG1329 consensus Phospholipase D1 [Lipid transport and metabolism]
Probab=8.32  E-value=1e+02  Score=37.89  Aligned_cols=11  Identities=55%  Similarity=1.081  Sum_probs=9.5

Q ss_pred             HHHhhhHHhhH
Q 005258          473 EILHWQYEKSL  483 (705)
Q Consensus       473 EaL~WqY~k~~  483 (705)
                      ++|||||+.++
T Consensus       646 aIl~wQyrTms  656 (887)
T KOG1329|consen  646 AILHWQYRTMS  656 (887)
T ss_pred             HHHHHHHHHHh
Confidence            68999999876


Done!