Citrus Sinensis ID: 005287

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700----

MMDPLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRAGESDMKMVNLRSDRTRAIAREQEATGIPDLDFSIRILVLGKTGVGKSATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGSSGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRFLLLCICTKVLGDANALLGFRDSIELGPLGNTRVPSMPHLLSSFLRHRSLSSPSEAENEIDEILASEIDEEDEYDQLPPIKILKKSQFERLSKSQKKSYLDELDYREILYFKKQLKEESRRRKENKLSKEECLPNDSTPDEQTSSEAVMLPDMVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLRRKAAENRSTEALETG

cccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccccEEEEEEcccccccHHHHHHHHcccccccccccccccEEEEEEEEEccEEEEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHHcHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEECccccccccccccccccHHHHHHHHccccEEEEEEEEcccccEEEEEEEEEEEEcccccCEEEEEEEECccccEEEEECccccccccccccccccEEEEECccCEEEEEEEEEEEEEcccEEEEEEcccEECcccccccccEEEEEccccccccccccEEccEEEcccccEEEEccccccccccccccEEEEEEcccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHccccccccHHHHHcc

***PLVKIEDLQVKFLRLLQRFGQSQDNILAVKVLYRLHLATLIRA**********************EATGIPDLDFSIRILVLGKTGVGKSATINSIFDQTKTETDAFQPATDCIREVKGSVNGIKVTFIDTPGFLPSCVRNVKRNRKIMLSVKKFIRRSPPDIVLYFERLDLISMGFSDFPLLKLMTEVFGTAIWFNTILVMTHSSSTLPEGSSGYPFSYESYVTQCTDLVQQRIHQAVSDARLENQVLLVENHPQCRRNVKGEQILPNGQIWKSRFLLLCICTKVLGDANALLGFRDSIELGPLGNT*****PHL**********************************************************YLDELDYREILYFK***************************************DMVVPPSFDPDCLAYRYRCLVTSDQWLVRPVLDLQGWDHDVGFDGINLETAVEIKSNVFASIAGQITKDKHDFNIHSESAAAYVDPEGPTYCIGLDVQSSGKDMIYTVHGNTKLRNFKHNVTDCGVSLTSFGNKNYVGAKLEDSLLVGKRLKLVMNAGRMGGSGQVAYGGSFEAILRGADYPVRNDNISLTMTALSFNKEVVLTGGFQSEFRPIRGLNMSVNANLNSRKMGQVCIKLNSSAHMEIALLAVFSIFRGLLR***************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Translocase of chloroplast 90, chloroplastic	GTPase involved in protein precursor import into chloroplasts. Seems to recognize chloroplast-destined precursor proteins and regulate their presentation to the translocation channel through GTP hydrolysis. Probably specialized in the import of nuclear encoded photosynthetic preproteins from the cytoplasm to the chloroplast.	probable	Q6S5G3

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DEF, chain A
Confidence level:very confident
Coverage over the Query: 97-298
View the alignment between query and template
View the model in PyMOL

Template: 1MKY, chain A
Confidence level:confident
Coverage over the Query: 8-212
View the alignment between query and template
View the model in PyMOL

Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 344-427
View the alignment between query and template
View the model in PyMOL