BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 005303
         (703 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2LD1|A Chain A, Structures And Chemical Shift Assignments For The Add
           Domain Of The Atrx Protein
 pdb|2LBM|A Chain A, Solution Structure Of The Add Domain Of Atrx Complexed
           With Histone Tail H3 1-15 K9me3
          Length = 142

 Score = 30.4 bits (67), Expect = 3.5,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 27/67 (40%), Gaps = 22/67 (32%)

Query: 141 AAAEQQGNGDDALF-CTLCNAEVRRFSKH------------CRSCDKCV---------DG 178
           A A+++G+G   +  CT C  +V  F K             C++C K           DG
Sbjct: 2   AMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDG 61

Query: 179 FDHHCRW 185
            D  CRW
Sbjct: 62  MDEQCRW 68


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.135    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,246,538
Number of Sequences: 62578
Number of extensions: 654440
Number of successful extensions: 967
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 967
Number of HSP's gapped (non-prelim): 1
length of query: 703
length of database: 14,973,337
effective HSP length: 106
effective length of query: 597
effective length of database: 8,340,069
effective search space: 4979021193
effective search space used: 4979021193
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)