Citrus Sinensis ID: 005338


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-
MEDSEGGLSFDFEGGLDAGPGMPTASNPAIQSDSTAAAAAAAANANHAAPSSSGAAPDHASAPVPHHSGRRSFRQTVCRHWLRSLCMKGDACGFLHQYDKSRMPVCRFFRLFGECREQDCVYKHTNEDIKECNMYKLGFCPNGPDCRYRHVKLPGPPPSVEEVLQKIQQISSYNHGNPNKHFQQRGAFSHQTDKSQFSQGPNAVNQGAAGKSSTAESANVHQQQLVQQPQQQGTQTTQMQNLPNGLPNQTNRNATPLPQGISRYFIVKSCNRENLELSVQQGVWATQRSNEAKLNEAFDSAENVILIFSVNRTRHFQGCAKMTSKIGGSVGGGNWKYAHGTAHYGRNFSVKWLKLCELSFHKTRHLRNPYNENLPVKISRDCQELEPSIGEQLAALLYLEPDSELMAISVAAEAKREEEKAKGVNPDNGGDNPDIVPFEDNEEEEEEESEEEEESLGTASQGRGRGRGMMWPGPMPLARGARPVPGMRGFPPMMIGADGFSYGVTPDGFPMPDLFGVAPRPFAPYGPRFSGDFTGPGGMMFPGRPPQPGSVFPPNGFGGMMMGPGRPPFMGGMGPAATNPRGGRPVGVPPPFPNQPQSSQNSSRAAKRDVRGSINDRNDRYSAGSDQGRAQEMGGPGRGPDDEVQYQQEGSKANQEDQYGSRNFRNDESESEDEAPRRSRHGEGKKKRRDSEGDAAASSDN
ccccccccEEEccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccEEEcccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHHHcEEEEccccHHHHHHHHHHcccEEEEEEEcccccEEEEEEEcccccccccccccccccccccccccCEEEEEEEEccccccccccccccccccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccc
****EGGLSFDFEGGLDAGPGM***********************************************RRSFRQTVCRHWLRSLCMKGDACGFLHQYDKSRMPVCRFFRLFGECREQDCVYKHTNEDIKECNMYKLGFCPNGPDCRYRHVKLPGPPPSVEEVLQKIQQISSYNHGNPNKHFQQR****************************************************QMQNLPNGLPNQTNRNATPLPQGISRYFIVKSCNRENLELSVQQGVWATQRSNEAKLNEAFDSAENVILIFSVNRTRHFQGCAKMTSKIGGSVGGGNWKYAHGTAHYGRNFSVKWLKLCELSFHKTRHLRNPYNENLPVKISRDCQELEPSIGEQLAALLYLEPDSELMAI***********************************************************************************PMMIGADGFSYGVTPDGFPMPDLFGVAPRPFAPYGPR*****************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDSEGGLSFDFEGGLDAGPGMPTASNPAIQSDSTAAAAAAAANANHAAPSSSGAAPDHASAPVPHHSGRRSFRQTVCRHWLRSLCMKGDACGFLHQYDKSRMPVCRFFRLFGECREQDCVYKHTNEDIKECNMYKLGFCPNGPDCRYRHVKLPGPPPSVEEVLQKIQQISSYNHGNPNKHFQQRGAFSHQTDKSQFSQGPNAVNQGAAGKSSTAESANVHQQQLVQQPQQQGTQTTQMQNLPNGLPNQTNRNATPLPQGISRYFIVKSCNRENLELSVQQGVWATQRSNEAKLNEAFDSAENVILIFSVNRTRHFQGCAKMTSKIGGSVGGGNWKYAHGTAHYGRNFSVKWLKLCELSFHKTRHLRNPYNENLPVKISRDCQELEPSIGEQLAALLYLEPDSELMAISVAAEAKREEEKAKGVNPDNGGDNPDIVPFEDNEEEEEEESEEEEESLGTASQGRGRGRGMMWPGPMPLARGARPVPGMRGFPPMMIGADGFSYGVTPDGFPMPDLFGVAPRPFAPYGPRFSGDFTGPGGMMFPGRPPQPGSVFPPNGFGGMMMGPGRPPFMGGMGPAATNPRGGRPVGVPPPFPNQPQSSQNSSRAAKRDVRGSINDRNDRYSAGSDQGRAQEMGGPGRGPDDEVQYQQEGSKANQEDQYGSRNFRNDESESEDEAPRRSRHGEGKKKRRDSEGDAAASSDN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger CCCH domain-containing protein 45 probableQ0DA50
Cleavage and polyadenylation specificity factor CPSF30 Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation. May interact with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition (By similarity). Binds RNA in a calcium-dependent manner.probableA9LNK9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YU6, chain A
Confidence level:very confident
Coverage over the Query: 258-399
View the alignment between query and template
View the model in PyMOL
Template: 2YUD, chain A
Confidence level:very confident
Coverage over the Query: 247-409
View the alignment between query and template
View the model in PyMOL
Template: 2D9N, chain A
Confidence level:very confident
Coverage over the Query: 71-139
View the alignment between query and template
View the model in PyMOL
Template: 2D9N, chain A
Confidence level:very confident
Coverage over the Query: 35-110
View the alignment between query and template
View the model in PyMOL
Template: 3U9G, chain A
Confidence level:confident
Coverage over the Query: 76-174
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 525-545
View the alignment between query and template
View the model in PyMOL