BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 005345
(701 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q6IBW4|CNDH2_HUMAN Condensin-2 complex subunit H2 OS=Homo sapiens GN=NCAPH2 PE=1 SV=1
Length = 605
Score = 33.9 bits (76), Expect = 5.1, Method: Compositional matrix adjust.
Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 8/57 (14%)
Query: 210 DFVSRKRRAKKTCTEQE------CCDGKGSDAEYDFVSETDSPDDDARGNLDMNKEK 260
DF+S KRRAK+ + QE G +AE +F+S D P D+R N+D+ ++
Sbjct: 83 DFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSLDDFP--DSRTNVDLKNDQ 137
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.317 0.133 0.396
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 262,921,009
Number of Sequences: 539616
Number of extensions: 11297986
Number of successful extensions: 26539
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 26532
Number of HSP's gapped (non-prelim): 13
length of query: 701
length of database: 191,569,459
effective HSP length: 125
effective length of query: 576
effective length of database: 124,117,459
effective search space: 71491656384
effective search space used: 71491656384
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)