Citrus Sinensis ID: 005369

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------70
MGTGASRNTDGDGSNGDDGKEGILDHAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSWDSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQGDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENLEPSTVRGIPDVSINSVQQTGAENGSSASLELDIEHYVVPAPSTSANSGLVYAANMTETPRSLSRAGVLSNADSSGSVSHSGISVDRPALIKDMEVSVPDPSKVYSSSGMVESKSVGTFSPLQKQDSHRGLFVDRGVGSPRLVKSASASTFNIDLKLDTETKNSMPAAAGAVAAAAVADQMLGPKEHRHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARNEVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKKNMPEEYEARKKDKLRYRYPRGESYLDVIQRFAACPCSIWCLCQS
cccccccccccccccccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccccEEEccccccccccccccccccccccccccccccccEEEccccccEEEEEEEEcccccccccccccHHHcccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccccEEEEccccccccccEEEEEEEcccccccEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHcHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcc
cccccccccccccccccccccccccccccEEEEEEEEccccccccccccEcccccEEccccHHHHHHHHHHHHHHHHEEEEcccccccEEEEEEEccccccccEEEEcccccEEEccccccccEEEEEEEcccEEEEEEEEEEcccccHHHHHHHHHHHHHHcccccEcccccEEEccccccccccccccHEEEEccccEcccccccccccEEEEHccccccHHHHccccccccccccccccccccccccccHHHcEEEccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHcccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccEEEEEccccHHHHHHHHHHcccccccccEEEEEcccEHHHHccEccccccEcHHHHHHHHHHHHHHHHHcccccccEEEEcHHHHHHHHHHHccccccEEcHHHcccccHHHcccEHHHHHHHcHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcc
mgtgasrntdgdgsngddgkegildhaggqFYVSLKMVNIKLkgdliphvygsvplvgswdsskalAMGRESASMWELsfvvppnhetldfkfllkpkygngpciveegpnrlltggalqgdsrsalfrldsdevLEYRVFikadrvspfdLAASWRAYQenlepstvrgipdvsinsvqqtgaengssasleldiehyvvpapstsansglvyaanmtetprslsragvlsnadssgsvshsgisvdrpalikdmevsvpdpskvysssgmvesksvgtfsplqkqdshrglfvdrgvgsprlvksasastfnidlkldtetknsmpAAAGAVAAAAVADQMLGPKEHRHLAIVLVglpargktfTAAKLTRYLRWLghdtkhfnvgkyrrlkhgvnqsadffradnpegmEARNEVAALAMEDMISWMheggqvgifdatnsSRKRRNMLMKMAEGNCKIIFLETICNDRDIIERNIRLkiqqspdyaeepdfeAGLQDFKNRLANYEkvyepvdegsyIKMIDMvsghggqiqvnnisgylpgRIVFFLVnthltprpilltrhgesrdnvrgriggdtilsDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTiltaspiagfpkIQWRALDeinagvcdgmtYEEIKKNMPEEYEARKKdklryryprgesYLDVIQRFaacpcsiwclcqs
mgtgasrntdgdgsngddGKEGILDHAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSWDSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQGDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENlepstvrgipDVSINSVQQTGAENGSSASLELDIEHYVVPAPSTSANSGLVYAANMTETPRSLSRAGVLSNadssgsvshsgisvdrpalikDMEVSVPDPSKVYSSSGMVESKSvgtfsplqkqdshRGLFVdrgvgsprlvksasastfnidlkLDTETKNSMPAAAGAVAAAAVADQMLGPKEHRHLAIVLvglpargktftAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADffradnpegMEARNEVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTprpilltrhgesrdnvrgrIGGDTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYeeikknmpeeyearkkdklryryPRGESYLDVIQRFAACPCSIWCLCQS
MGTGASRNTdgdgsngddgKEGILDHAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSWDSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQGDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENLEPSTVRGIPDVSINSVQQTGAENGSSASLELDIEHYVVPAPSTSANSGLVYAANMTETPRSLSRAGVLSNADssgsvshsgisvDRPALIKDMEVSVPDPSKVYSSSGMVESKSVGTFSPLQKQDSHRGLFVDRGVGSPRLVKSASASTFNIDLKLDTETKNSMPaaagavaaaavaDQMLGPKEHRHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARNEVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKKNMPEEYEARKKDKLRYRYPRGESYLDVIQRFAACPCSIWCLCQS
**********************ILDHAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSWDSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQGDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENL*******************************DIEHYVV*****************************************************************************************************************I*****************AVAAAAVADQMLGPKEHRHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFR************VAALAMEDMISWMHEGGQVGIFDAT********MLMKMAEGNCKIIFLETICNDRDIIERNIRLKIQQ*********FEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIK*************KLRYRYPRGESYLDVIQRFAACPCSIWCLC**
***************************GGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSWDSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQGDSRSALFRLDSDEVLEYRVFIKADRVSPFD******************************************LDIEHYVV*****************************************************************************************************************************************************HLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARNEVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKKNMPEEYEARKKDKLRYRYPRGESYLDVIQRFAACPCSIWCLC**
***************GDDGKEGILDHAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSWDSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQGDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENLEPSTVRGIPDVSINSVQQTGAENGSSASLELDIEHYVVPAPSTSANSGLVYAANMTET***********************ISVDRPALIKDMEVSVPDPSKVYSSSGMVESKSVGTFSPLQKQDSHRGLFVDRGVGSPRLVKSASASTFNIDLKLDTETKNSMPAAAGAVAAAAVADQMLGPKEHRHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARNEVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKKNMPEEYEARKKDKLRYRYPRGESYLDVIQRFAACPCSIWCLCQS
*************************HAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSWDSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQGDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENLEPSTVRGIPDVSINSVQQ******SSASLELDIEHYVVPAPSTSANSGLVYAANMTETPRSLSRA**********************ALIKDMEVSVPDPSK***********************SHRGLFVDRGVGSP***************************************QMLGPKEHRHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARNEVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKKNMPEEYEARKKDKLRYRYPRGESYLDVIQRFAACPCSIWCLCQS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTGASRNTDGDGSNGDDGKEGILDHAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSWDSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQGDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENLEPSTVRGIPDVSINSVQQTGAENGSSASLELDIEHYVVPAPSTSANSGLVYAANMTETPRSLSRAGVLSNADSSGSVSHSGISVDRPALIKDMEVSVPDPSKVYSSSGMVESKSVGTFSPLQKQDSHRGLFVDRGVGSPRLVKSASASTFNIDLKLDTETKNSMPAAAGAVAAAAVADQMLGPKEHRHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARNEVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKKNMPEEYEARKKDKLRYRYPRGESYLDVIQRFAACPCSIWCLCQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query699 2.2.26 [Sep-21-2011]
Q9MB58744 6-phosphofructo-2-kinase/ yes no 0.961 0.903 0.764 0.0
P16118471 6-phosphofructo-2-kinase/ yes no 0.463 0.687 0.473 6e-84
Q91348470 6-phosphofructo-2-kinase/ yes no 0.464 0.691 0.473 5e-83
P70266471 6-phosphofructo-2-kinase/ yes no 0.463 0.687 0.473 7e-83
P49872471 6-phosphofructo-2-kinase/ yes no 0.463 0.687 0.470 2e-82
P07953471 6-phosphofructo-2-kinase/ yes no 0.463 0.687 0.467 4e-82
Q16875 520 6-phosphofructo-2-kinase/ no no 0.464 0.625 0.463 5e-81
O35552 555 6-phosphofructo-2-kinase/ no no 0.476 0.6 0.460 7e-81
Q5R9C1 514 6-phosphofructo-2-kinase/ no no 0.476 0.647 0.460 7e-81
Q91309470 6-phosphofructo-2-kinase/ N/A no 0.462 0.687 0.467 1e-80
>sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 Back     alignment and function desciption
 Score = 1040 bits (2688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/691 (76%), Positives = 587/691 (84%), Gaps = 19/691 (2%)

Query: 1   MGTGASRNTDGDGSNGDDGKEGILDHAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSW 60
           MG+GAS+NT+ D    +          GGQ YVSLKM N K++G+L PHVYGS+PL+GSW
Sbjct: 1   MGSGASKNTEEDDDGSN--------GGGGQLYVSLKMENSKVEGELTPHVYGSLPLIGSW 52

Query: 61  DSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQ 120
           D SKAL M RESA M ELSFVVPP+HETLDFKFLLKPK  N PCIVEEG NRLLTGG+LQ
Sbjct: 53  DPSKALPMQRESALMSELSFVVPPDHETLDFKFLLKPKNRNTPCIVEEGENRLLTGGSLQ 112

Query: 121 GDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENLEPSTVRGIPDVSINSVQ 180
           GD+R ALFRL+ D ++E+RVFI ADRVSP DLA SWRAY+ENL+PSTVRGIPDVSIN   
Sbjct: 113 GDARLALFRLEGDVIVEFRVFINADRVSPIDLATSWRAYRENLQPSTVRGIPDVSINPDP 172

Query: 181 QTGAENGSSASLELDIEHYVVPAPSTSANSGLVYAANMTETPRSLSRAGVLSNADSSGSV 240
           ++        SLELD+ HY VPAP+ SANS LVYAA+  E PRSLS +G   N DS+   
Sbjct: 173 KSA--ECPLESLELDLAHYEVPAPAPSANSYLVYAADNAENPRSLSASGSFRN-DSTPKA 229

Query: 241 SH-----SGISVDRPALIKDMEVSVPDPSKVYSSSGMVESKSVGTFSPLQKQDSHRGLFV 295
           +      SG++VD     K+M + VPD S +YS+ G  ESKSV T SP Q++D  +GLFV
Sbjct: 230 AQRNSEDSGVTVDGSPSAKEMTIVVPDSSNIYSAFGEAESKSVETLSPFQQKDGQKGLFV 289

Query: 296 DRGVGSPRLVKSASASTFNIDLKLDTETKNSMPAAAGAVAAAAVADQMLGPKEHRHLAIV 355
           DRGVGSPRLVKS SAS+F ID K   + KNSMPAAAGAVAAAAVADQMLGPKE RHLAIV
Sbjct: 290 DRGVGSPRLVKSLSASSFLIDTK---QIKNSMPAAAGAVAAAAVADQMLGPKEDRHLAIV 346

Query: 356 LVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEAR 415
           LVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVN SADFFRADNPEG+EAR
Sbjct: 347 LVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNMSADFFRADNPEGVEAR 406

Query: 416 NEVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDII 475
            EVAALAMEDMI+WM EGGQVGIFDATNS+R RRNMLMKMAEG CKIIFLET+CND  II
Sbjct: 407 TEVAALAMEDMIAWMQEGGQVGIFDATNSTRVRRNMLMKMAEGKCKIIFLETLCNDERII 466

Query: 476 ERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQI 535
           ERNIRLKIQQSPDY+EE DFEAG++DF++RLANYEKVYEPV+EGSYIKMIDMVSG+GGQI
Sbjct: 467 ERNIRLKIQQSPDYSEEMDFEAGVRDFRDRLANYEKVYEPVEEGSYIKMIDMVSGNGGQI 526

Query: 536 QVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKL 595
           QVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGES DNVRGRIGGD+++SD+G++YAKKL
Sbjct: 527 QVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESMDNVRGRIGGDSVISDSGKLYAKKL 586

Query: 596 ANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKK 655
           A+FVEKRLKSE+AASIWTSTLQRT LTAS I GFPK+QWRALDEINAGVCDGMTYEE+KK
Sbjct: 587 ASFVEKRLKSEKAASIWTSTLQRTNLTASSIVGFPKVQWRALDEINAGVCDGMTYEEVKK 646

Query: 656 NMPEEYEARKKDKLRYRYPRGESYLDVIQRF 686
           NMPEEYE+RKKDKLRYRYPRGESYLDVIQR 
Sbjct: 647 NMPEEYESRKKDKLRYRYPRGESYLDVIQRL 677
Synthesis and degradation of fructose 2,6-bisphosphate. Regulates carbon partitioning between sucrose versus starch during the diurnal cycle.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 6
>sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 Back     alignment and function description
>sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 Back     alignment and function description
>sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=2 SV=2 Back     alignment and function description
>sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 Back     alignment and function description
>sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 Back     alignment and function description
>sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 Back     alignment and function description
>sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 Back     alignment and function description
>sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 Back     alignment and function description
>sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query699
225434528756 PREDICTED: 6-phosphofructo-2-kinase/fruc 0.979 0.906 0.878 0.0
449450828751 PREDICTED: 6-phosphofructo-2-kinase/fruc 0.974 0.906 0.859 0.0
224055341748 predicted protein [Populus trichocarpa] 0.968 0.905 0.850 0.0
118486201749 unknown [Populus trichocarpa] 0.967 0.902 0.842 0.0
14149116745 fructose-6-phosphate 2-kinase/fructose-2 0.964 0.904 0.827 0.0
356569515732 PREDICTED: 6-phosphofructo-2-kinase/fruc 0.951 0.908 0.817 0.0
297848998743 hypothetical protein ARALYDRAFT_470732 [ 0.961 0.904 0.768 0.0
15222304744 fructose-2,6-bisphosphatase [Arabidopsis 0.961 0.903 0.764 0.0
13096098744 fructose-6-phosphate 2-kinase/fructose-2 0.961 0.903 0.762 0.0
3170230750 fructose-6-phosphate 2-kinase /fructose- 0.977 0.910 0.752 0.0
>gi|225434528|ref|XP_002276394.1| PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 [Vitis vinifera] gi|297745867|emb|CBI15923.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1228 bits (3176), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/690 (87%), Positives = 635/690 (92%), Gaps = 5/690 (0%)

Query: 1   MGTGASRNTDGDGSNGDDGKEGILDHAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSW 60
           MGT  S+N D  GS+G + +E  LD AGGQ YVSLKM N KLKG+LIPHVYGSVPLVGSW
Sbjct: 1   MGTSGSKNLDS-GSHGGEEREENLDQAGGQLYVSLKMENYKLKGELIPHVYGSVPLVGSW 59

Query: 61  DSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQ 120
           DSSKALAM RES SMWELSFVVPPNHETLDFKFLLKPKY N PC+VEEG NR+LTGG LQ
Sbjct: 60  DSSKALAMERESTSMWELSFVVPPNHETLDFKFLLKPKYSNTPCVVEEGLNRVLTGGTLQ 119

Query: 121 GDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENLEPSTVRGIPDVSINSVQ 180
           GD+R ALFRL+ DEVLE RVFIKADRVSPFDLAASWRAYQENL+PSTVRGIPDVSIN+V 
Sbjct: 120 GDARLALFRLNGDEVLESRVFIKADRVSPFDLAASWRAYQENLKPSTVRGIPDVSINAVP 179

Query: 181 QTGAENGSSASLELDIEHYVVPAPSTSANSGLVYAANMTETPRSLSRAGVLSNADSSGSV 240
           + GAENGSSASLELD+EHYVVPAP+TSANSGLVYAANM ETPRSL+  GV SN DSSG  
Sbjct: 180 EMGAENGSSASLELDLEHYVVPAPATSANSGLVYAANMAETPRSLTHLGVFSNTDSSGGA 239

Query: 241 SHS----GISVDRPALIKDMEVSVPDPSKVYSSSGMVESKSVGTFSPLQKQDSHRGLFVD 296
           S+S    G+SVDRPA IK+MEV VPDPSKVYS SGMVESKSVGTFSPLQKQDSHRGLFVD
Sbjct: 240 SYSNKDAGVSVDRPATIKEMEVIVPDPSKVYSGSGMVESKSVGTFSPLQKQDSHRGLFVD 299

Query: 297 RGVGSPRLVKSASASTFNIDLKLDTETKNSMPAAAGAVAAAAVADQMLGPKEHRHLAIVL 356
           RGVGSPRLVKSASA+TF  DLKLD+ETKN+MPAAAGAVAAAAVADQMLGPKE RHLAIVL
Sbjct: 300 RGVGSPRLVKSASAATFTADLKLDSETKNAMPAAAGAVAAAAVADQMLGPKEDRHLAIVL 359

Query: 357 VGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARN 416
           VGLPARGKTFTAAKLTRYLRWLGH+TKHFNVGKYRRLKHG NQ+ADFFR DNPEGMEARN
Sbjct: 360 VGLPARGKTFTAAKLTRYLRWLGHETKHFNVGKYRRLKHGTNQTADFFRGDNPEGMEARN 419

Query: 417 EVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDIIE 476
           EVAALAM+DMISWM EGGQVGIFDATNS+RKRRNMLMKMAEGNCKIIFLETICND  IIE
Sbjct: 420 EVAALAMDDMISWMQEGGQVGIFDATNSTRKRRNMLMKMAEGNCKIIFLETICNDERIIE 479

Query: 477 RNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQ 536
           RNIRLKIQQSPDYAEEPDFEAGLQDFK RLANYEKVYEPV+EGSYIKMIDMV G  GQIQ
Sbjct: 480 RNIRLKIQQSPDYAEEPDFEAGLQDFKIRLANYEKVYEPVEEGSYIKMIDMVGGQDGQIQ 539

Query: 537 VNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKLA 596
           VNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDT LSDAGE+YAKKL+
Sbjct: 540 VNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTALSDAGELYAKKLS 599

Query: 597 NFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKKN 656
            FVEKRLK ERAASIWTSTLQRTILTASPI GFPKIQWRALDEINAGVCDGMTYEEIKKN
Sbjct: 600 TFVEKRLKPERAASIWTSTLQRTILTASPIVGFPKIQWRALDEINAGVCDGMTYEEIKKN 659

Query: 657 MPEEYEARKKDKLRYRYPRGESYLDVIQRF 686
           MPEEYE+RKKDKLRYRYPRGESYLDVIQR 
Sbjct: 660 MPEEYESRKKDKLRYRYPRGESYLDVIQRL 689

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449450828|ref|XP_004143164.1| PREDICTED: 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase-like [Cucumis sativus] gi|449518605|ref|XP_004166327.1| PREDICTED: 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224055341|ref|XP_002298489.1| predicted protein [Populus trichocarpa] gi|222845747|gb|EEE83294.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118486201|gb|ABK94943.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|14149116|dbj|BAB55655.1| fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase [Bruguiera gymnorhiza] Back     alignment and taxonomy information
>gi|356569515|ref|XP_003552945.1| PREDICTED: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|297848998|ref|XP_002892380.1| hypothetical protein ARALYDRAFT_470732 [Arabidopsis lyrata subsp. lyrata] gi|297338222|gb|EFH68639.1| hypothetical protein ARALYDRAFT_470732 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15222304|ref|NP_172191.1| fructose-2,6-bisphosphatase [Arabidopsis thaliana] gi|75192772|sp|Q9MB58.1|F26_ARATH RecName: Full=6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase; Short=6PF-2-K/Fru-2,6-P2ase; Short=AtF2KP; Short=PFK/FBPase; Includes: RecName: Full=6-phosphofructo-2-kinase; Includes: RecName: Full=Fructose-2,6-bisphosphatase gi|8117172|dbj|BAA96353.1| fructose-6-phosphate,2-kinase/fructose-2, 6-bisphosphatase [Arabidopsis thaliana] gi|332189956|gb|AEE28077.1| fructose-2,6-bisphosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|13096098|gb|AAF04293.2|AF190739_1 fructose-6-phosphate 2-kinase/fructose-2,6-bisphosphatase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3170230|gb|AAC18055.1| fructose-6-phosphate 2-kinase /fructose-2,6-bisphosphatase [Spinacia oleracea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query699
TAIR|locus:2007367744 F2KP ""fructose-2,6-bisphospha 0.961 0.903 0.744 1.8e-268
ZFIN|ZDB-GENE-031031-4469 pfkfb4l "6-phosphofructo-2-kin 0.462 0.688 0.479 3.3e-79
UNIPROTKB|G4N6N9443 MGG_06524 "Fructose-2,6-bispho 0.474 0.749 0.465 1.1e-78
UNIPROTKB|F1MEV5471 PFKFB1 "6-phosphofructo-2-kina 0.460 0.683 0.476 7.9e-78
UNIPROTKB|P16118471 PFKFB1 "6-phosphofructo-2-kina 0.460 0.683 0.476 1.3e-77
MGI|MGI:107816471 Pfkfb1 "6-phosphofructo-2-kina 0.460 0.683 0.476 9e-77
UNIPROTKB|Q91348470 Q91348 "6-phosphofructo-2-kina 0.463 0.689 0.477 1.5e-76
UNIPROTKB|F1PAV3471 PFKFB1 "Uncharacterized protei 0.460 0.683 0.470 1.5e-76
UNIPROTKB|F1Q3K3435 PFKFB1 "Uncharacterized protei 0.460 0.740 0.470 1.5e-76
UNIPROTKB|P49872471 PFKFB1 "6-phosphofructo-2-kina 0.460 0.683 0.473 1.9e-76
TAIR|locus:2007367 F2KP ""fructose-2,6-bisphosphatase"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2582 (914.0 bits), Expect = 1.8e-268, P = 1.8e-268
 Identities = 513/689 (74%), Positives = 568/689 (82%)

Query:     1 MGTGASRNTXXXXXXXXXXKEGILDHAGGQFYVSLKMVNIKLKGDLIPHVYGSVPLVGSW 60
             MG+GAS+NT           +G  +  GGQ YVSLKM N K++G+L PHVYGS+PL+GSW
Sbjct:     1 MGSGASKNTEEDD-------DGS-NGGGGQLYVSLKMENSKVEGELTPHVYGSLPLIGSW 52

Query:    61 DSSKALAMGRESASMWELSFVVPPNHETLDFKFLLKPKYGNGPCIVEEGPNRLLTGGALQ 120
             D SKAL M RESA M ELSFVVPP+HETLDFKFLLKPK  N PCIVEEG NRLLTGG+LQ
Sbjct:    53 DPSKALPMQRESALMSELSFVVPPDHETLDFKFLLKPKNRNTPCIVEEGENRLLTGGSLQ 112

Query:   121 GDSRSALFRLDSDEVLEYRVFIKADRVSPFDLAASWRAYQENLEPSTVRGIPDVSINSVQ 180
             GD+R ALFRL+ D ++E+RVFI ADRVSP DLA SWRAY+ENL+PSTVRGIPDVSIN   
Sbjct:   113 GDARLALFRLEGDVIVEFRVFINADRVSPIDLATSWRAYRENLQPSTVRGIPDVSINPDP 172

Query:   181 QTGAENGSSASLELDIEHYVVPAPSTSANSGLVYAANMTETPRSLSRAGVLSNADXXXXX 240
             ++ AE     SLELD+ HY VPAP+ SANS LVYAA+  E PRSLS +G   N       
Sbjct:   173 KS-AECPLE-SLELDLAHYEVPAPAPSANSYLVYAADNAENPRSLSASGSFRNDSTPKAA 230

Query:   241 XXXXXXX----DRPALIKDMEVSVPDPSKVYSSSGMVESKSVGTFSPLQKQDSHRGLFVD 296
                        D     K+M + VPD S +YS+ G  ESKSV T SP Q++D  +GLFVD
Sbjct:   231 QRNSEDSGVTVDGSPSAKEMTIVVPDSSNIYSAFGEAESKSVETLSPFQQKDGQKGLFVD 290

Query:   297 RGVGSPRLVKSASASTFNIDLKLDTETKNSMPXXXXXXXXXXXXDQMLGPKEHRHLAIVL 356
             RGVGSPRLVKS SAS+F ID K   + KNSMP            DQMLGPKE RHLAIVL
Sbjct:   291 RGVGSPRLVKSLSASSFLIDTK---QIKNSMPAAAGAVAAAAVADQMLGPKEDRHLAIVL 347

Query:   357 VGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARN 416
             VGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVN SADFFRADNPEG+EAR 
Sbjct:   348 VGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNMSADFFRADNPEGVEART 407

Query:   417 EVAALAMEDMISWMHEGGQVGIFDATNSSRKRRNMLMKMAEGNCKIIFLETICNDRDIIE 476
             EVAALAMEDMI+WM EGGQVGIFDATNS+R RRNMLMKMAEG CKIIFLET+CND  IIE
Sbjct:   408 EVAALAMEDMIAWMQEGGQVGIFDATNSTRVRRNMLMKMAEGKCKIIFLETLCNDERIIE 467

Query:   477 RNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEGSYIKMIDMVSGHGGQIQ 536
             RNIRLKIQQSPDY+EE DFEAG++DF++RLANYEKVYEPV+EGSYIKMIDMVSG+GGQIQ
Sbjct:   468 RNIRLKIQQSPDYSEEMDFEAGVRDFRDRLANYEKVYEPVEEGSYIKMIDMVSGNGGQIQ 527

Query:   537 VNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTILSDAGEIYAKKLA 596
             VNNISGYLPGRIVFFLVNTHLTPRPILLTRHGES DNVRGRIGGD+++SD+G++YAKKLA
Sbjct:   528 VNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESMDNVRGRIGGDSVISDSGKLYAKKLA 587

Query:   597 NFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKKN 656
             +FVEKRLKSE+AASIWTSTLQRT LTAS I GFPK+QWRALDEINAGVCDGMTYEE+KKN
Sbjct:   588 SFVEKRLKSEKAASIWTSTLQRTNLTASSIVGFPKVQWRALDEINAGVCDGMTYEEVKKN 647

Query:   657 MPEEYEARKKDKLRYRYPRGESYLDVIQR 685
             MPEEYE+RKKDKLRYRYPRGESYLDVIQR
Sbjct:   648 MPEEYESRKKDKLRYRYPRGESYLDVIQR 676
GO:0003824 "catalytic activity" evidence=IEA
GO:0003873 "6-phosphofructo-2-kinase activity" evidence=IEA
GO:0004331 "fructose-2,6-bisphosphate 2-phosphatase activity" evidence=IEA;IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006000 "fructose metabolic process" evidence=IEA;IDA
GO:0006003 "fructose 2,6-bisphosphate metabolic process" evidence=IEA;IDA
GO:0008152 "metabolic process" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=IEA
GO:2001070 "starch binding" evidence=IEA
GO:0043609 "regulation of carbon utilization" evidence=IMP
GO:0006002 "fructose 6-phosphate metabolic process" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0042732 "D-xylose metabolic process" evidence=RCA
ZFIN|ZDB-GENE-031031-4 pfkfb4l "6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G4N6N9 MGG_06524 "Fructose-2,6-bisphosphatase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
UNIPROTKB|F1MEV5 PFKFB1 "6-phosphofructo-2-kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P16118 PFKFB1 "6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:107816 Pfkfb1 "6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q91348 Q91348 "6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAV3 PFKFB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3K3 PFKFB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P49872 PFKFB1 "6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9MB58F26_ARATH3, ., 1, ., 3, ., 4, 60.76410.96130.9032yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer2.7.1LOW CONFIDENCE prediction!
4th Layer2.7.1.105LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
pfam01591219 pfam01591, 6PF2K, 6-phosphofructo-2-kinase 1e-103
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-37
pfam00300154 pfam00300, His_Phos_1, Histidine phosphatase super 1e-26
COG0406208 COG0406, phoE, Broad specificity phosphatase PhoE 4e-25
smart00855158 smart00855, PGAM, Phosphoglycerate mutase family 4e-25
smart0106588 smart01065, CBM_2, Starch binding domain 1e-13
TIGR03162177 TIGR03162, ribazole_cobC, alpha-ribazole phosphata 2e-13
cd07067153 cd07067, HP_PGM_like, Histidine phosphatase domain 9e-13
PRK13463203 PRK13463, PRK13463, phosphatase PhoE; Provisional 2e-10
cd07040153 cd07040, HP, Histidine phosphatase domain found in 3e-10
pfam0068696 pfam00686, CBM_20, Starch binding domain 1e-08
cd0581699 cd05816, CBM20_DPE2_repeat2, Disproportionating en 4e-08
pfam13671143 pfam13671, AAA_33, AAA domain 1e-06
cd0546796 cd05467, CBM20, The family 20 carbohydrate-binding 4e-06
PRK03482215 PRK03482, PRK03482, phosphoglycerate mutase; Provi 2e-05
cd05811106 cd05811, CBM20_glucoamylase, Glucoamylase (glucan1 2e-04
TIGR03848204 TIGR03848, MSMEG_4193, probable phosphomutase, MSM 2e-04
COG0588230 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohyd 5e-04
PRK07238372 PRK07238, PRK07238, bifunctional RNase H/acid phos 8e-04
PLN02950909 PLN02950, PLN02950, 4-alpha-glucanotransferase 0.001
cd0580895 cd05808, CBM20_alpha_amylase, Alpha-amylase, C-ter 0.002
>gnl|CDD|216591 pfam01591, 6PF2K, 6-phosphofructo-2-kinase Back     alignment and domain information 
 Score =  314 bits (806), Expect = e-103
 Identities = 107/221 (48%), Positives = 143/221 (64%), Gaps = 6/221 (2%)

Query: 343 MLGPKEH-RHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSA 401
             GP        IV+VGLPARGKT+ + KLTRYL W+G  TK FNVG+YRR         
Sbjct: 1   STGPNFTNSKTLIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRRSAVKAYSDY 60

Query: 402 DFFRADNPEGMEARNEVAALAMEDMISWM-HEGGQVGIFDATNSSRKRRNMLMKMAEGN- 459
           +FFR DN EGM+ R + A  A+ D+++++  E GQV IFDATN++R+RR M++  AE N 
Sbjct: 61  EFFRPDNEEGMKIREQCALAALNDVLAYLNEESGQVAIFDATNTTRERRKMILDFAEENG 120

Query: 460 CKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDE- 518
            K+ FLE+IC+D +II RNI+L    SPDY  +P  EA + DF  R+  YEK YEP+DE 
Sbjct: 121 LKVFFLESICDDPEIIARNIKLVKFSSPDYKGKPPEEA-IDDFMKRIECYEKQYEPLDEH 179

Query: 519 GSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTP 559
              +  I ++   G  I VNN+ GYL  RIV++L+N H+TP
Sbjct: 180 DEDLSYIKVIDV-GQSIVVNNVQGYLQSRIVYYLMNIHVTP 219

This enzyme occurs as a bifunctional enzyme with fructose-2,6-bisphosphatase. The bifunctional enzyme catalyzes both the synthesis and degradation of fructose-2,6-bisphosphate, a potent regulator of glycolysis. This enzyme contains a P-loop motif. Length = 219
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215845 pfam00300, His_Phos_1, Histidine phosphatase superfamily (branch 1) Back     alignment and domain information
>gnl|CDD|223483 COG0406, phoE, Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>gnl|CDD|214859 smart00855, PGAM, Phosphoglycerate mutase family Back     alignment and domain information
>gnl|CDD|215006 smart01065, CBM_2, Starch binding domain Back     alignment and domain information
>gnl|CDD|234131 TIGR03162, ribazole_cobC, alpha-ribazole phosphatase Back     alignment and domain information
>gnl|CDD|132718 cd07067, HP_PGM_like, Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|172065 PRK13463, PRK13463, phosphatase PhoE; Provisional Back     alignment and domain information
>gnl|CDD|132716 cd07040, HP, Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>gnl|CDD|216060 pfam00686, CBM_20, Starch binding domain Back     alignment and domain information
>gnl|CDD|99890 cd05816, CBM20_DPE2_repeat2, Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2 Back     alignment and domain information
>gnl|CDD|222307 pfam13671, AAA_33, AAA domain Back     alignment and domain information
>gnl|CDD|119437 cd05467, CBM20, The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase) Back     alignment and domain information
>gnl|CDD|179583 PRK03482, PRK03482, phosphoglycerate mutase; Provisional Back     alignment and domain information
>gnl|CDD|99886 cd05811, CBM20_glucoamylase, Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>gnl|CDD|163560 TIGR03848, MSMEG_4193, probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>gnl|CDD|223661 COG0588, GpmA, Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|180903 PRK07238, PRK07238, bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|215512 PLN02950, PLN02950, 4-alpha-glucanotransferase Back     alignment and domain information
>gnl|CDD|99883 cd05808, CBM20_alpha_amylase, Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 699
KOG0234438 consensus Fructose-6-phosphate 2-kinase/fructose-2 100.0
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 100.0
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 100.0
PRK13463203 phosphatase PhoE; Provisional 99.94
PRK14116228 gpmA phosphoglyceromutase; Provisional 99.94
PRK15004199 alpha-ribazole phosphatase; Provisional 99.94
PRK14119228 gpmA phosphoglyceromutase; Provisional 99.94
PRK01295206 phosphoglyceromutase; Provisional 99.93
PRK01112228 phosphoglyceromutase; Provisional 99.93
PRK14117230 gpmA phosphoglyceromutase; Provisional 99.93
PRK14118227 gpmA phosphoglyceromutase; Provisional 99.93
COG0406208 phoE Broad specificity phosphatase PhoE and relate 99.93
TIGR03162177 ribazole_cobC alpha-ribazole phosphatase. Members 99.92
PRK14120249 gpmA phosphoglyceromutase; Provisional 99.92
TIGR01258245 pgm_1 phosphoglycerate mutase, BPG-dependent, fami 99.92
PRK13462203 acid phosphatase; Provisional 99.92
TIGR03848204 MSMEG_4193 probable phosphomutase, MSMEG_4193 fami 99.92
PRK03482215 phosphoglycerate mutase; Provisional 99.92
PRK14115247 gpmA phosphoglyceromutase; Provisional 99.91
smart00855155 PGAM Phosphoglycerate mutase family. Phosphoglycer 99.9
PRK07238372 bifunctional RNase H/acid phosphatase; Provisional 99.9
PF00300158 His_Phos_1: Histidine phosphatase superfamily (bra 99.9
KOG0235214 consensus Phosphoglycerate mutase [Carbohydrate tr 99.86
PTZ00123236 phosphoglycerate mutase like-protein; Provisional 99.79
cd0581699 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DP 99.78
COG0588230 GpmA Phosphoglycerate mutase 1 [Carbohydrate trans 99.77
PF0068696 CBM_20: Starch binding domain; InterPro: IPR002044 99.75
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 99.68
cd05807101 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrat 99.68
cd0546796 CBM20 The family 20 carbohydrate-binding module (C 99.65
cd05820103 CBM20_novamyl Novamyl (also known as acarviose tra 99.65
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 99.65
COG0645170 Predicted kinase [General function prediction only 99.63
cd0581097 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrol 99.62
cd05817100 CBM20_DSP Dual-specificity phosphatase (DSP), N-te 99.61
cd0580999 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 99.59
cd0580895 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM2 99.59
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 99.58
cd05815101 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DP 99.58
cd05814120 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate- 99.57
cd05811106 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-g 99.57
PLN02950909 4-alpha-glucanotransferase 99.52
PTZ00122299 phosphoglycerate mutase; Provisional 99.52
cd0581892 CBM20_water_dikinase Phosphoglucan water dikinase 99.51
cd0581395 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 99.51
cd07067153 HP_PGM_like Histidine phosphatase domain found in 99.49
cd05806112 CBM20_laforin Laforin protein tyrosine phosphatase 99.44
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 99.43
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.42
PHA02530300 pseT polynucleotide kinase; Provisional 99.41
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 99.39
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 99.39
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 99.33
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 99.32
PRK06762166 hypothetical protein; Provisional 99.31
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 99.31
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 99.3
cd07040153 HP Histidine phosphatase domain found in a functio 99.29
TIGR00249152 sixA phosphohistidine phosphatase SixA. 99.28
PRK03846198 adenylylsulfate kinase; Provisional 99.28
COG0703172 AroK Shikimate kinase [Amino acid transport and me 99.28
PRK00889175 adenylylsulfate kinase; Provisional 99.27
PRK10848159 phosphohistidine phosphatase; Provisional 99.27
COG2062163 SixA Phosphohistidine phosphatase SixA [Signal tra 99.27
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 99.26
KOG4754248 consensus Predicted phosphoglycerate mutase [Carbo 99.25
COG4088261 Predicted nucleotide kinase [Nucleotide transport 99.24
COG4639168 Predicted kinase [General function prediction only 99.23
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 99.22
PRK06193206 hypothetical protein; Provisional 99.22
PRK15416201 lipopolysaccharide core heptose(II)-phosphate phos 99.2
PRK11545163 gntK gluconate kinase 1; Provisional 99.17
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 99.17
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 99.17
PRK05541176 adenylylsulfate kinase; Provisional 99.14
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 99.09
PRK13948182 shikimate kinase; Provisional 99.09
PRK00625173 shikimate kinase; Provisional 99.09
PRK12339197 2-phosphoglycerate kinase; Provisional 99.09
PLN02950 909 4-alpha-glucanotransferase 99.06
PRK13946184 shikimate kinase; Provisional 98.98
PRK14532188 adenylate kinase; Provisional 98.98
KOG3734272 consensus Predicted phosphoglycerate mutase [Carbo 98.98
KOG3062281 consensus RNA polymerase II elongator associated p 98.94
PRK12337475 2-phosphoglycerate kinase; Provisional 98.94
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 98.93
PRK13949169 shikimate kinase; Provisional 98.93
PRK14527191 adenylate kinase; Provisional 98.93
KOG4238 627 consensus Bifunctional ATP sulfurylase/adenosine 5 98.91
PRK13947171 shikimate kinase; Provisional 98.9
PRK14531183 adenylate kinase; Provisional 98.9
PRK09825176 idnK D-gluconate kinase; Provisional 98.88
PRK00131175 aroK shikimate kinase; Reviewed 98.87
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 98.86
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 98.84
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 98.84
PRK05057172 aroK shikimate kinase I; Reviewed 98.83
PRK01184184 hypothetical protein; Provisional 98.78
PLN02200234 adenylate kinase family protein 98.77
PLN02199303 shikimate kinase 98.77
PRK03731171 aroL shikimate kinase II; Reviewed 98.75
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 98.73
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.71
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 98.66
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.63
PRK12338319 hypothetical protein; Provisional 98.6
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 98.59
PRK14530215 adenylate kinase; Provisional 98.58
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 98.56
PRK06696223 uridine kinase; Validated 98.53
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 98.53
PRK00279215 adk adenylate kinase; Reviewed 98.48
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 98.47
PRK06217183 hypothetical protein; Validated 98.43
KOG4609284 consensus Predicted phosphoglycerate mutase [Gener 98.39
PRK03839180 putative kinase; Provisional 98.39
PRK04040188 adenylate kinase; Provisional 98.35
PRK08356195 hypothetical protein; Provisional 98.34
PRK06761282 hypothetical protein; Provisional 98.3
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 98.29
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.28
PRK14528186 adenylate kinase; Provisional 98.28
PRK04220301 2-phosphoglycerate kinase; Provisional 98.27
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 98.27
PRK00698205 tmk thymidylate kinase; Validated 98.27
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.25
PRK13975196 thymidylate kinase; Provisional 98.24
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.24
PRK07667193 uridine kinase; Provisional 98.23
PRK08233182 hypothetical protein; Provisional 98.23
PLN02674244 adenylate kinase 98.22
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 98.21
PTZ00088229 adenylate kinase 1; Provisional 98.2
PRK02496184 adk adenylate kinase; Provisional 98.19
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.17
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.15
PRK00300205 gmk guanylate kinase; Provisional 98.15
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 98.13
PRK04182180 cytidylate kinase; Provisional 98.12
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 98.11
PRK13808333 adenylate kinase; Provisional 98.11
PRK14737186 gmk guanylate kinase; Provisional 98.09
PLN02459261 probable adenylate kinase 98.09
PRK14526211 adenylate kinase; Provisional 98.08
PRK13973213 thymidylate kinase; Provisional 98.08
PRK14738206 gmk guanylate kinase; Provisional 98.06
PRK14529223 adenylate kinase; Provisional 98.06
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 98.06
PRK06547172 hypothetical protein; Provisional 98.01
PRK07261171 topology modulation protein; Provisional 98.0
PRK05480209 uridine/cytidine kinase; Provisional 97.96
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 97.96
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 97.95
PRK08118167 topology modulation protein; Reviewed 97.93
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.89
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.89
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 97.89
PRK15453290 phosphoribulokinase; Provisional 97.82
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 97.81
PLN02924220 thymidylate kinase 97.79
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 97.74
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 97.72
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 97.71
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 97.7
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 97.68
PRK13974212 thymidylate kinase; Provisional 97.68
KOG2134422 consensus Polynucleotide kinase 3' phosphatase [Re 97.67
COG4185187 Uncharacterized protein conserved in bacteria [Fun 97.66
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.62
PRK14730195 coaE dephospho-CoA kinase; Provisional 97.62
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 97.61
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 97.61
PLN02348395 phosphoribulokinase 97.6
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 97.58
PRK07933213 thymidylate kinase; Validated 97.57
PRK00081194 coaE dephospho-CoA kinase; Reviewed 97.55
PTZ00301210 uridine kinase; Provisional 97.54
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.5
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.49
PRK10867433 signal recognition particle protein; Provisional 97.49
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 97.48
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 97.47
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 97.46
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 97.46
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 97.45
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 97.44
PRK00771437 signal recognition particle protein Srp54; Provisi 97.44
TIGR00064272 ftsY signal recognition particle-docking protein F 97.41
PLN02842 505 nucleotide kinase 97.4
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 97.37
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 97.37
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 97.34
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.33
KOG0780483 consensus Signal recognition particle, subunit Srp 97.32
TIGR00959428 ffh signal recognition particle protein. This mode 97.27
cd03115173 SRP The signal recognition particle (SRP) mediates 97.26
PRK13976209 thymidylate kinase; Provisional 97.24
PRK05439311 pantothenate kinase; Provisional 97.24
PLN02165334 adenylate isopentenyltransferase 97.24
PRK14974336 cell division protein FtsY; Provisional 97.23
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 97.21
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.2
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.17
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 97.16
PRK10416318 signal recognition particle-docking protein FtsY; 97.13
PRK07429327 phosphoribulokinase; Provisional 97.13
COG3896205 Chloramphenicol 3-O-phosphotransferase [Defense me 97.11
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 97.1
PRK14733204 coaE dephospho-CoA kinase; Provisional 97.09
cd07061242 HP_HAP_like Histidine phosphatase domain found in 97.03
PRK00023225 cmk cytidylate kinase; Provisional 97.0
PRK14731208 coaE dephospho-CoA kinase; Provisional 96.99
PRK14734200 coaE dephospho-CoA kinase; Provisional 96.94
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 96.93
PF00004132 AAA: ATPase family associated with various cellula 96.93
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 96.93
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.9
KOG4622291 consensus Predicted nucleotide kinase [General fun 96.88
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 96.86
PRK09435332 membrane ATPase/protein kinase; Provisional 96.85
PTZ00451244 dephospho-CoA kinase; Provisional 96.81
PHA03132580 thymidine kinase; Provisional 96.79
PRK091692316 hypothetical protein; Validated 96.78
PLN02772398 guanylate kinase 96.78
COG1936180 Predicted nucleotide kinase (related to CMP and AM 96.76
PRK14732196 coaE dephospho-CoA kinase; Provisional 96.76
PLN02318 656 phosphoribulokinase/uridine kinase 96.74
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 96.74
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.73
PHA00729226 NTP-binding motif containing protein 96.72
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.71
KOG1533290 consensus Predicted GTPase [General function predi 96.69
PLN02422232 dephospho-CoA kinase 96.61
smart00382148 AAA ATPases associated with a variety of cellular 96.54
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 96.53
COG0552340 FtsY Signal recognition particle GTPase [Intracell 96.52
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.47
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 96.47
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 96.42
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.42
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 96.41
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 96.36
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.35
PLN02840421 tRNA dimethylallyltransferase 96.31
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 96.28
cd01394218 radB RadB. The archaeal protein radB shares simila 96.28
PRK06893229 DNA replication initiation factor; Validated 96.25
COG3709192 Uncharacterized component of phosphonate metabolis 96.25
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 96.24
PRK12377248 putative replication protein; Provisional 96.22
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 96.22
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.21
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 96.21
cd0286182 E_set_proteins_like E or "early" set-like proteins 96.2
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.2
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.19
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 96.18
CHL00181287 cbbX CbbX; Provisional 96.18
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.16
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.09
PRK13768253 GTPase; Provisional 96.08
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.05
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 96.0
PLN02796347 D-glycerate 3-kinase 95.98
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.98
PF13173128 AAA_14: AAA domain 95.97
PRK08084235 DNA replication initiation factor; Provisional 95.95
PRK09361225 radB DNA repair and recombination protein RadB; Pr 95.94
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 95.91
PRK08116268 hypothetical protein; Validated 95.9
PRK07952244 DNA replication protein DnaC; Validated 95.87
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.87
PLN03025319 replication factor C subunit; Provisional 95.86
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 95.83
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.83
PLN03046460 D-glycerate 3-kinase; Provisional 95.8
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.78
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 95.78
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.76
PRK05973237 replicative DNA helicase; Provisional 95.75
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 95.75
TIGR03709264 PPK2_rel_1 polyphosphate:nucleotide phosphotransfe 95.74
COG1660286 Predicted P-loop-containing kinase [General functi 95.73
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 95.7
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.68
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 95.68
PRK13695174 putative NTPase; Provisional 95.67
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.65
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 95.65
PRK08727233 hypothetical protein; Validated 95.63
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 95.63
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 95.63
KOG3308225 consensus Uncharacterized protein of the uridine k 95.61
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.56
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 95.55
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.55
PF00328 347 His_Phos_2: Histidine phosphatase superfamily (bra 95.54
PRK08181269 transposase; Validated 95.53
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.52
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.51
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.51
PRK05642234 DNA replication initiation factor; Validated 95.48
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.45
PHA02544316 44 clamp loader, small subunit; Provisional 95.45
PRK00149450 dnaA chromosomal replication initiation protein; R 95.45
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 95.45
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 95.41
PLN02748468 tRNA dimethylallyltransferase 95.4
TIGR03707230 PPK2_P_aer polyphosphate kinase 2, PA0141 family. 95.39
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.37
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 95.36
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 95.35
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 95.35
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 95.32
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 95.32
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.31
PRK04296190 thymidine kinase; Provisional 95.31
PRK08939306 primosomal protein DnaI; Reviewed 95.31
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 95.3
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 95.3
cd03116159 MobB Molybdenum is an essential trace element in t 95.3
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 95.3
PRK09087226 hypothetical protein; Validated 95.27
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 95.27
PRK13342413 recombination factor protein RarA; Reviewed 95.27
cd02034116 CooC The accessory protein CooC, which contains a 95.26
PRK08099399 bifunctional DNA-binding transcriptional repressor 95.23
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 95.2
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 95.18
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 95.17
PRK06921266 hypothetical protein; Provisional 95.14
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 95.13
PRK06526254 transposase; Provisional 95.13
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 95.13
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.04
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.03
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 95.02
TIGR03708 493 poly_P_AMP_trns polyphosphate:AMP phosphotransfera 95.01
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 95.01
PRK04195482 replication factor C large subunit; Provisional 95.01
cd0285979 AMPKbeta_GBD_like AMP-activated protein kinase (AM 94.99
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 94.98
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 94.98
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 94.98
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 94.97
COG4175386 ProV ABC-type proline/glycine betaine transport sy 94.94
COG2256436 MGS1 ATPase related to the helicase subunit of the 94.92
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.92
PF05729166 NACHT: NACHT domain 94.9
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 94.9
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.89
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 94.88
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 94.88
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 94.86
PRK14494229 putative molybdopterin-guanine dinucleotide biosyn 94.83
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 94.82
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 94.8
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.78
PRK09183259 transposase/IS protein; Provisional 94.76
PRK14087450 dnaA chromosomal replication initiation protein; P 94.75
cd03246173 ABCC_Protease_Secretion This family represents the 94.74
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 94.72
PRK04328249 hypothetical protein; Provisional 94.7
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.65
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 94.63
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 94.62
PRK06620214 hypothetical protein; Validated 94.59
PRK06835329 DNA replication protein DnaC; Validated 94.57
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.57
cd03114148 ArgK-like The function of this protein family is u 94.56
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 94.54
PRK14088440 dnaA chromosomal replication initiation protein; P 94.52
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 94.49
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.47
COG5324758 Uncharacterized conserved protein [Function unknow 94.47
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 94.45
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 94.41
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.4
PRK13341 725 recombination factor protein RarA/unknown domain f 94.39
PRK00440319 rfc replication factor C small subunit; Reviewed 94.38
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 94.38
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.37
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.37
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 94.35
KOG1969 877 consensus DNA replication checkpoint protein CHL12 94.34
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 94.33
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.28
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 94.27
KOG3078235 consensus Adenylate kinase [Nucleotide transport a 94.22
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.18
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.17
PHA02575227 1 deoxynucleoside monophosphate kinase; Provisiona 94.15
KOG2170344 consensus ATPase of the AAA+ superfamily [General 94.14
PF1324576 AAA_19: Part of AAA domain 94.1
PRK05636505 replicative DNA helicase; Provisional 94.06
PRK12402337 replication factor C small subunit 2; Reviewed 94.04
TIGR00362405 DnaA chromosomal replication initiator protein Dna 93.98
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 93.97
TIGR00665434 DnaB replicative DNA helicase. This model describe 93.93
COG4240300 Predicted kinase [General function prediction only 93.9
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 93.87
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 93.86
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 93.86
cd00983325 recA RecA is a bacterial enzyme which has roles in 93.85
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 93.85
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.84
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 93.83
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 93.82
KOG1384348 consensus tRNA delta(2)-isopentenylpyrophosphate t 93.81
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 93.79
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 93.78
COG0470325 HolB ATPase involved in DNA replication [DNA repli 93.75
PRK08760476 replicative DNA helicase; Provisional 93.75
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 93.69
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 93.68
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 93.65
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 93.64
PRK05707328 DNA polymerase III subunit delta'; Validated 93.64
PRK11823446 DNA repair protein RadA; Provisional 93.59
PRK13886241 conjugal transfer protein TraL; Provisional 93.58
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.56
COG1855604 ATPase (PilT family) [General function prediction 93.55
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.52
PRK14086617 dnaA chromosomal replication initiation protein; P 93.48
KOG0734752 consensus AAA+-type ATPase containing the peptidas 93.48
COG4615546 PvdE ABC-type siderophore export system, fused ATP 93.42
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 93.42
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 93.41
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 93.39
cd00154159 Rab Rab family. Rab GTPases form the largest famil 93.38
PRK06321472 replicative DNA helicase; Provisional 93.38
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.35
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 93.35
PRK08006471 replicative DNA helicase; Provisional 93.31
PRK05595444 replicative DNA helicase; Provisional 93.28
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 93.24
cd0285499 Glycogen_branching_enzyme_like_N_term Glycogen bra 93.24
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 93.21
smart00178184 SAR Sar1p-like members of the Ras-family of small 93.2
cd02035217 ArsA ArsA ATPase functionas as an efflux pump loca 93.19
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 93.18
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 93.14
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthes 93.14
PRK06067234 flagellar accessory protein FlaH; Validated 93.13
PRK08506472 replicative DNA helicase; Provisional 93.11
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.1
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 93.1
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 93.05
COG1484254 DnaC DNA replication protein [DNA replication, rec 93.03
PRK15455 644 PrkA family serine protein kinase; Provisional 92.97
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.97
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 92.96
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 92.95
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 92.94
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 92.92
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 92.91
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 92.9
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 92.9
PF07726131 AAA_3: ATPase family associated with various cellu 92.89
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 92.88
PF03976228 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR 92.88
CHL00195489 ycf46 Ycf46; Provisional 92.87
PRK10536262 hypothetical protein; Provisional 92.84
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 92.84
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 92.83
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 92.81
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 92.8
PRK12422445 chromosomal replication initiation protein; Provis 92.78
PRK14489366 putative bifunctional molybdopterin-guanine dinucl 92.76
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 92.74
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 92.73
cd00881189 GTP_translation_factor GTP translation factor fami 92.7
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 92.68
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 92.66
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 92.63
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 92.59
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 92.58
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 92.57
PRK09165497 replicative DNA helicase; Provisional 92.56
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 92.55
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 92.53
PRK03992389 proteasome-activating nucleotidase; Provisional 92.52
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 92.51
PRK06851367 hypothetical protein; Provisional 92.49
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 92.46
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 92.45
PRK05748448 replicative DNA helicase; Provisional 92.43
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 92.42
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 92.38
TIGR00101199 ureG urease accessory protein UreG. This model rep 92.37
PRK10646153 ADP-binding protein; Provisional 92.35
PHA02542473 41 41 helicase; Provisional 92.33
KOG0731774 consensus AAA+-type ATPase containing the peptidas 92.27
cd04171164 SelB SelB subfamily. SelB is an elongation factor 92.27
cd03216163 ABC_Carb_Monos_I This family represents the domain 92.25
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 92.24
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 92.23
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 92.17
PRK09112351 DNA polymerase III subunit delta'; Validated 92.12
cd0285885 Esterase_N_term Esterase N-terminal domain. Estera 92.09
>KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-61  Score=519.27  Aligned_cols=342  Identities=51%  Similarity=0.873  Sum_probs=320.1

Q ss_pred             CCCccEEEEEEccCCCChhHHHHHHHHHHhhcCCCceEeehhhHHHHhhCCCCCCCCcCCCCHHHHHHHHHHHHHHHHHH
Q 005369          347 KEHRHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARNEVAALAMEDM  426 (699)
Q Consensus       347 ~~~~~~lIvmvGLPGSGKSTlAr~La~~L~~~gi~tdv~~~gdyRr~~~g~~~~~~f~~~~~~~~~~~~~~vA~~~l~dl  426 (699)
                      ....|.+|+|+|||++|||+++.+|.++|+|.++++..||.++|||.......+..||.++++++...+.+++..++.|+
T Consensus        24 ~~~~~~~ivmvglpA~gKt~is~kl~ryl~w~~~~tk~fn~g~yrr~~~~~~~s~~ff~p~n~~~~~lr~~~a~~~l~D~  103 (438)
T KOG0234|consen   24 FMGSKLVIVMVGLPARGKTYISSKLTRYLNWLGVNTKVFNVGEYRREAVKKVDSEPFFLPDNAEASKLRKQLALLALNDL  103 (438)
T ss_pred             ccCCceEEEEecCCccCcchhhhhHHHHHHhhccccccccHHHHHHHHhcccccccccccCChhhhhhhHHHHHHHhhhH
Confidence            35689999999999999999999999999999999999999999998877666678999999999999999999999999


Q ss_pred             HHHHh-cCCeEEEEeCCCCCHHHHHHHHHH-H-cCCceEEEEEEEeCCHHHHHHHHHHhhccCCCCCCCCChHHHHHHHH
Q 005369          427 ISWMH-EGGQVGIFDATNSSRKRRNMLMKM-A-EGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFK  503 (699)
Q Consensus       427 ~~~L~-~~G~vVIlDAtn~~~e~R~~l~el-~-~~~~~vifIE~~c~d~e~i~rrI~~r~~~spD~s~~~d~e~al~d~~  503 (699)
                      ..|+. .+|+++|+||||.++++|+.+..+ . +.++++.|||+.|+|++++.+||+.++..+|||+++ +.+.++++|+
T Consensus       104 ~~~l~~~~g~vai~Datnttr~rrk~i~~~~~~~~~~kv~FiEs~c~D~~ii~~NI~~~~~~spdy~~~-~~e~a~~dfl  182 (438)
T KOG0234|consen  104 LHFLIKENGQVAIFDATNTTRERRKRIIDFAEREAGFKVFFIESVCNDPNLINNNIREVKHVSPDYKGK-DQEEALKDFL  182 (438)
T ss_pred             HHHhhccCCceEEecCCCCCHHHHHHHHHHHhhcCCceEEEEEeecCCchhHHhhhhhhhhcCCCcCCC-CHHHHHHHHH
Confidence            99998 569999999999999999999999 3 699999999999999999999999888899999999 9999999999


Q ss_pred             HHHHhhhhhccCCCCC-----CceEEeecccCCcceeEEeccccCCCcceeeeecccCCCCcceEEecccccccccCCcc
Q 005369          504 NRLANYEKVYEPVDEG-----SYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRI  578 (699)
Q Consensus       504 ~Ri~~y~~~yEpl~e~-----~yik~in~~~~~g~~~~~n~i~gyL~~rIvffLmN~~~~~~~I~LVRHGeS~~N~~~~~  578 (699)
                      +||..|++.|||+++.     +|||+||+    |+++++|+|+|||++++||||||+|.++++|||+|||++++|..++.
T Consensus       183 ~ri~~ye~~YePld~~~d~~lsyik~in~----g~~~~~~~i~~~l~srivy~lmN~~~~pR~i~l~r~geS~~n~~gri  258 (438)
T KOG0234|consen  183 KRIRNYEKYYEPLDRARDKDLSYIKIINV----GEEIVVHNIEGYLQSRIVYYLMNIHTTPRTIYLTRHGESEFNVEGRI  258 (438)
T ss_pred             HHHHhhhhccCcCChhhccccceEEEecc----cceEEEecccceehhhhhhhhhccccCCceEEEEecCCCcccccccc
Confidence            9999999999999932     99999999    99999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCHHHHHHHHHHHHHHHHHhccCCCCEEEEcChHHHHHHHhhh-cCCCccccccccccccCcCCCCCHHHHHHhC
Q 005369          579 GGDTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPI-AGFPKIQWRALDEINAGVCDGMTYEEIKKNM  657 (699)
Q Consensus       579 ~GD~pLTe~G~~QA~~La~~L~~~l~~~~~~~V~sSpL~RA~QTA~~i-~g~~v~~~~~L~E~~~G~~eG~t~~ei~~~~  657 (699)
                      +||++|++.|.++|+.+++++.++..  .-..||||++.||+|||+.+ ....+.++..|+|++.|.|+|+++++|.+.|
T Consensus       259 ggds~ls~~g~~ya~~l~~f~~~~~~--~dl~vwts~~~rti~ta~~l~~~~~~~~~~~Ldei~ag~~~g~t~eeI~~~~  336 (438)
T KOG0234|consen  259 GGDSPLSERGSQYAKSLIKFVEEQSS--SDLDVWTSQRKRTIQTAEGLKLDYSVEQWKALDEIDAGVCEGLTYEEIETNY  336 (438)
T ss_pred             CCcccccHHHHHHHHHHHHHHhhhcc--cCceeccchHHHHhhhHhhcCcchhhhhHhhcCcccccccccccHHHHHHhC
Confidence            99999999999999999999987622  22489999999999999966 2233489999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q 005369          658 PEEYEARKKDKLRYRYPRGESYLDVIQRFAACPCSIWC  695 (699)
Q Consensus       658 P~~~~~~~~d~~~~~~PgGES~~dv~~Rv~~~L~~L~~  695 (699)
                      |+++.....|+++|+||+||||.|+.+|+++++-+|-.
T Consensus       337 p~e~~~r~~dky~yry~~gESy~D~v~RlePvImElEr  374 (438)
T KOG0234|consen  337 PEEFALRDKDKYRYRYPGGESYSDLVQRLEPVIMELER  374 (438)
T ss_pred             chhhhhccCCcceeecCCCCCHHHHHHhhhhHhHhhhh
Confidence            99999999999999999999999999999999988743

>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>PRK13463 phosphatase PhoE; Provisional Back     alignment and domain information
>PRK14116 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK15004 alpha-ribazole phosphatase; Provisional Back     alignment and domain information
>PRK14119 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01295 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK01112 phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14117 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>PRK14118 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>COG0406 phoE Broad specificity phosphatase PhoE and related phosphatases [General function prediction only] Back     alignment and domain information
>TIGR03162 ribazole_cobC alpha-ribazole phosphatase Back     alignment and domain information
>PRK14120 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>TIGR01258 pgm_1 phosphoglycerate mutase, BPG-dependent, family 1 Back     alignment and domain information
>PRK13462 acid phosphatase; Provisional Back     alignment and domain information
>TIGR03848 MSMEG_4193 probable phosphomutase, MSMEG_4193 family Back     alignment and domain information
>PRK03482 phosphoglycerate mutase; Provisional Back     alignment and domain information
>PRK14115 gpmA phosphoglyceromutase; Provisional Back     alignment and domain information
>smart00855 PGAM Phosphoglycerate mutase family Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PF00300 His_Phos_1: Histidine phosphatase superfamily (branch 1); InterPro: IPR013078 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>KOG0235 consensus Phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00123 phosphoglycerate mutase like-protein; Provisional Back     alignment and domain information
>cd05816 CBM20_DPE2_repeat2 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 2 Back     alignment and domain information
>COG0588 GpmA Phosphoglycerate mutase 1 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00686 CBM_20: Starch binding domain; InterPro: IPR002044 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd05807 CBM20_CGTase CGTase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd05467 CBM20 The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase) Back     alignment and domain information
>cd05820 CBM20_novamyl Novamyl (also known as acarviose transferase, ATase, maltogenic alpha-amylase, glucan 1,4-alpha-maltohydrolase, and AcbD), C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>cd05810 CBM20_alpha_MTH Glucan 1,4-alpha-maltotetraohydrolase (alpha-MTH), C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd05817 CBM20_DSP Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd05809 CBM20_beta_amylase Beta-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd05808 CBM20_alpha_amylase Alpha-amylase, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd05815 CBM20_DPE2_repeat1 Disproportionating enzyme 2 (DPE2), N-terminal CBM20 (carbohydrate-binding module, family 20) domain, repeat 1 Back     alignment and domain information
>cd05814 CBM20_Prei4 Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd05811 CBM20_glucoamylase Glucoamylase (glucan1,4-alpha-glucosidase), C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>PTZ00122 phosphoglycerate mutase; Provisional Back     alignment and domain information
>cd05818 CBM20_water_dikinase Phosphoglucan water dikinase (also known as alpha-glucan water dikinase), N-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd05813 CBM20_genethonin_1 Genethonin-1, C-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>cd07067 HP_PGM_like Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>cd05806 CBM20_laforin Laforin protein tyrosine phosphatase, N-terminal CBM20 (carbohydrate-binding module, family 20) domain Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd07040 HP Histidine phosphatase domain found in a functionally diverse set of proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>TIGR00249 sixA phosphohistidine phosphatase SixA Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK10848 phosphohistidine phosphatase; Provisional Back     alignment and domain information
>COG2062 SixA Phosphohistidine phosphatase SixA [Signal transduction mechanisms] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>KOG4754 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK06193 hypothetical protein; Provisional Back     alignment and domain information
>PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PLN02950 4-alpha-glucanotransferase Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>KOG3734 consensus Predicted phosphoglycerate mutase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG4609 consensus Predicted phosphoglycerate mutase [General function prediction only] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd07061 HP_HAP_like Histidine phosphatase domain found in histidine acid phosphatases and phytases; contains a His residue which is phosphorylated during the reaction Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4622 consensus Predicted nucleotide kinase [General function prediction only] Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>PRK09169 hypothetical protein; Validated Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>cd02861 E_set_proteins_like E or "early" set-like proteins Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF00328 His_Phos_2: Histidine phosphatase superfamily (branch 2); InterPro: IPR000560 The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding domain (GBD) Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG5324 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PHA02575 1 deoxynucleoside monophosphate kinase; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd02854 Glycogen_branching_enzyme_like_N_term Glycogen branching enzyme-like N-terminus domain Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>PF03976 PPK2: Polyphosphate kinase 2 (PPK2); InterPro: IPR022488 This presumed domain is found in one or two copies per protein Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd02858 Esterase_N_term Esterase N-terminal domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
2axn_A 520 Crystal Structure Of The Human Inducible Form 6- Ph 5e-82
1k6m_A432 Crystal Structure Of Human Liver 6-Phosphofructo-2- 6e-82
3bif_A468 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase 8e-77
1bif_A469 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase 8e-77
2bif_A469 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase 1e-75
1c7z_A191 Regulatory Complex Of Fructose-2,6-Bisphosphatase L 8e-34
1fbt_A190 The Bisphosphatase Domain Of The Bifunctional Rat L 2e-33
1tip_A191 The Bisphosphatase Domain Of The Bifunctional Rat L 1e-32
1ebb_A202 Bacillus Stearothermophilus Yhfr Length = 202 9e-10
1h2e_A207 Bacillus Stearothermophilus Phoe (Previously Known 1e-09
>pdb|2AXN|A Chain A, Crystal Structure Of The Human Inducible Form 6- Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Length = 520 Back     alignment and structure 
Iteration: 1

 Score =  302 bits (773), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 162/352 (46%), Positives = 229/352 (65%), Gaps = 19/352 (5%)
Query: 345 GPK-EHRHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADF 403
           GPK  +    IV+VGLPARGKT+ + KLTRYL W+G  TK FNVG+YRR       S +F
Sbjct: 28  GPKLTNSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNF 87
Query: 404 FRADNPEGMEARNEVAALAMEDMISWM-HEGGQVGIFDATNSSRKRRNMLMKMA-EGNCK 461
           FR DN E M+ R + A  A+ D+ S++  EGGQ+ +FDATN++R+RR+M++  A E + K
Sbjct: 88  FRPDNEEAMKVRKQCALAALRDVKSYLAKEGGQIAVFDATNTTRERRHMILHFAKENDFK 147
Query: 462 IIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVD---- 517
             F+E++C+D  ++  NI      SPDY +    EA + DF  R++ YE  Y+P+D    
Sbjct: 148 AFFIESVCDDPTVVASNIMEVKISSPDYKDCNSAEA-MDDFMKRISCYEASYQPLDPDKC 206
Query: 518 --EGSYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVR 575
             + S IK+ID+    G +  VN +  ++  RIV++L+N H+ PR I L RHGE+  N++
Sbjct: 207 DRDLSLIKVIDV----GRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQ 262
Query: 576 GRIGGDTILSDAGEIYAKKLANFVEKR-LKSERAASIWTSTLQRTILTASPIAGFPKIQW 634
           GRIGGD+ LS  G+ +A  L+ FVE++ LK  R   +WTS L+ TI TA  +   P  QW
Sbjct: 263 GRIGGDSGLSSRGKKFASALSKFVEEQNLKDLR---VWTSQLKSTIQTAEALR-LPYEQW 318
Query: 635 RALDEINAGVCDGMTYEEIKKNMPEEYEARKKDKLRYRYPRGESYLDVIQRF 686
           +AL+EI+AGVC+ +TYEEI+   PEEY  R++DK  YRYP GESY D++QR 
Sbjct: 319 KALNEIDAGVCEELTYEEIRDTYPEEYALREQDKYYYRYPTGESYQDLVQRL 370
>pdb|1K6M|A Chain A, Crystal Structure Of Human Liver 6-Phosphofructo-2-KinaseFRUCTOSE-2, 6-Bisphosphatase Length = 432 Back     alignment and structure
>pdb|3BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Empty 6-Pf-2k Active Site Length = 468 Back     alignment and structure
>pdb|1BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Bifunctional Enzyme Complexed With Atp-G-S And Phosphate Length = 469 Back     alignment and structure
>pdb|2BIF|A Chain A, 6-Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase H256a Mutant With F6p In Phosphatase Active Site Length = 469 Back     alignment and structure
>pdb|1C7Z|A Chain A, Regulatory Complex Of Fructose-2,6-Bisphosphatase Length = 191 Back     alignment and structure
>pdb|1FBT|A Chain A, The Bisphosphatase Domain Of The Bifunctional Rat Liver 6- Phosphofructo-2-KinaseFRUCTOSE-2,6-Bisphosphatase Length = 190 Back     alignment and structure
>pdb|1TIP|A Chain A, The Bisphosphatase Domain Of The Bifunctional Rat Liver 6- Phosphofructo-2-kinase/fructose-2,6-bisphosphatase Length = 191 Back     alignment and structure
>pdb|1EBB|A Chain A, Bacillus Stearothermophilus Yhfr Length = 202 Back     alignment and structure
>pdb|1H2E|A Chain A, Bacillus Stearothermophilus Phoe (Previously Known As Yhfr) In Complex With Phosphate Length = 207 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 1e-136
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 1e-134
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 2e-28
3e9c_A 265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 2e-21
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 2e-21
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 3e-20
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 8e-20
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 3e-17
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 1e-13
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 1e-13
3dcy_A 275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 5e-13
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 1e-11
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 3e-10
3f3k_A 265 Uncharacterized protein YKR043C; structural genomi 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1ac0_A108 Glucoamylase; hydrolase, starch binding domain; HE 2e-08
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 2e-08
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 1e-07
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 1e-07
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 1e-07
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 2e-07
2vn4_A599 Glucoamylase; hydrolase, carbohydrate binding, gly 4e-06
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 7e-06
1vem_A516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 5e-05
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 5e-05
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 2e-04
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 4e-04
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Length = 469 Back     alignment and structure
 Score =  407 bits (1046), Expect = e-136
 Identities = 150/341 (43%), Positives = 216/341 (63%), Gaps = 15/341 (4%)

Query: 352 LAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEG 411
             IV+VGLPARGKT+ + KLTRYL ++G  T+ FNVG+YRR      +S +FF  DN EG
Sbjct: 40  TLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEEG 99

Query: 412 MEARNEVAALAMEDMISWM-HEGGQVGIFDATNSSRKRRNMLMKMA-EGNCKIIFLETIC 469
           ++ R + A  A+ D+  ++  EGG V +FDATN++R+RR M+     +   K  F+E+IC
Sbjct: 100 LKIRKQCALAALNDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESIC 159

Query: 470 NDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDE-----GSYIKM 524
            D ++I  NI      SPDY    D +   +DF  R+  YE  YE +DE      SYIK+
Sbjct: 160 VDPEVIAANIVQVKLGSPDYVNR-DSDEATEDFMRRIECYENSYESLDEEQDRDLSYIKI 218

Query: 525 IDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGGDTIL 584
           +D+    G    VN ++ ++  RIV++L+N H+TPR I L RHGES  N++GRIGGD  L
Sbjct: 219 MDV----GQSYVVNRVADHIQSRIVYYLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGL 274

Query: 585 SDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGV 644
           S  G  ++K LA F+  +  + +   ++TS ++RTI TA  +   P  Q++ L+EI+AGV
Sbjct: 275 SPRGREFSKHLAQFISDQ--NIKDLKVFTSQMKRTIQTAEAL-SVPYEQFKVLNEIDAGV 331

Query: 645 CDGMTYEEIKKNMPEEYEARKKDKLRYRYPRGESYLDVIQR 685
           C+ MTYEEI+ + P E+  R +DK RYRYP+GESY D++QR
Sbjct: 332 CEEMTYEEIQDHYPLEFALRDQDKYRYRYPKGESYEDLVQR 372
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Length = 520 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Length = 207 Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Length = 265 Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Length = 177 Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Length = 213 Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Length = 208 Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Length = 219 Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Length = 214 Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Length = 237 Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Length = 275 Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Length = 202 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Length = 265 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ac0_A Glucoamylase; hydrolase, starch binding domain; HET: GLC BGC GLO; NMR {Aspergillus niger} SCOP: b.3.1.1 PDB: 1acz_A* 1kul_A 1kum_A Length = 108 Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Length = 273 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Length = 263 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>2vn4_A Glucoamylase; hydrolase, carbohydrate binding, glycoside hydrolase family 15, amyloglucosidase; HET: MAN NAG BTB; 1.85A {Hypocrea jecorina} PDB: 2vn7_A* Length = 599 Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Length = 527 Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Length = 516 Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Length = 264 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query699
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 100.0
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 100.0
1fzt_A211 Phosphoglycerate mutase; open B-sheet-helices, iso 99.94
1h2e_A207 Phosphatase, YHFR; hydrolase, broad specificity ph 99.94
2a6p_A208 Possible phosphoglycerate mutase GPM2; predicted p 99.93
3kkk_A258 Phosphoglycerate mutase; PGAM, glycolysis, malaria 99.92
1e58_A249 Phosphoglycerate mutase; phosphohistidine, glycoly 99.92
3hjg_A213 Putative alpha-ribazole-5'-phosphate phosphatase C 99.92
1yfk_A262 Phosphoglycerate mutase 1; alpha/beta, isomerase, 99.91
3d8h_A267 Glycolytic phosphoglycerate mutase; structural gen 99.91
2hhj_A267 Bisphosphoglycerate mutase; isomerase; HET: NEP DG 99.91
3gp3_A257 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.91
1qhf_A240 Protein (phosphoglycerate mutase); transferase (ph 99.91
4emb_A274 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.91
1rii_A265 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.91
4eo9_A268 2,3-bisphosphoglycerate-dependent phosphoglycerat; 99.9
2qni_A219 AGR_C_517P, uncharacterized protein ATU0299; MCSG, 99.9
3dcy_A 275 Regulator protein; OMIM 610775, C12ORF5, tigar, TP 99.9
3e9c_A 265 ZGC:56074; histidine phosphatase, hydrolase; 2.00A 99.9
1v37_A177 Phosphoglycerate mutase; riken structu genomics/pr 99.89
3f3k_A 265 Uncharacterized protein YKR043C; structural genomi 99.89
3r7a_A237 Phosphoglycerate mutase, putative; structural geno 99.89
3d4i_A273 STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domai 99.85
3c7t_A263 Ecdysteroid-phosphate phosphatase; ecdysone, 2H-ph 99.85
3mbk_A264 Ubiquitin-associated and SH3 domain-containing PR; 99.83
3eoz_A214 Putative phosphoglycerate mutase; PGAM, malaria, s 99.74
3mxo_A202 Serine/threonine-protein phosphatase PGAM5, mitoc; 99.72
2z0b_A131 GDE5, KIAA1434, putative glycerophosphodiester pho 99.71
1ac0_A108 Glucoamylase; hydrolase, starch binding domain; HE 99.7
1ujc_A161 Phosphohistidine phosphatase SIXA; alpha-beta fold 99.57
3bmv_A683 Cyclomaltodextrin glucanotransferase; glycosidase, 99.56
1d3c_A686 Cyclodextrin glycosyltransferase; alpha-amylase, p 99.56
1cyg_A680 Cyclodextrin glucanotransferase; glycosyltransfera 99.56
2rfl_A173 Putative phosphohistidine phosphatase SIXA; alpha- 99.54
1vem_A516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 99.45
2vn4_A599 Glucoamylase; hydrolase, carbohydrate binding, gly 99.39
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 99.34
3f2i_A172 ALR0221 protein; alpha-beta protein, structural ge 99.34
1gcy_A527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 99.34
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 99.33
4hbz_A186 Putative phosphohistidine phosphatase, SIXA; struc 99.32
1qho_A686 Alpha-amylase; glycoside hydrolase, starch degrada 99.31
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 99.28
3fjy_A364 Probable MUTT1 protein; dimer, protein structure i 99.28
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 99.24
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 99.2
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.19
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 99.17
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 99.14
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 99.11
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 99.11
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 99.1
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 99.07
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 99.05
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 99.04
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 99.0
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 98.99
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 98.96
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 98.95
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 98.92
2vli_A183 Antibiotic resistance protein; transferase, tunica 98.92
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.92
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.91
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.9
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.89
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.86
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 98.84
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.84
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.83
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 98.76
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 98.75
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 98.73
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.68
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.66
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 98.66
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 98.65
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 98.64
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.62
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.62
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 98.59
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 98.58
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.57
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.57
3tlx_A243 Adenylate kinase 2; structural genomics, structura 98.56
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.53
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 98.52
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 98.52
1via_A175 Shikimate kinase; structural genomics, transferase 98.49
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.48
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.41
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.38
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 98.37
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 98.36
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.36
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 98.35
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 98.33
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 98.33
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.3
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.29
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.27
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 98.25
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 98.22
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.21
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 98.19
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 98.16
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 98.14
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 98.14
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.11
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.1
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 98.09
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 98.05
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.05
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 98.04
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 97.99
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 97.97
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 97.95
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.94
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.94
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 97.9
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.88
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.87
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 97.86
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.84
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.82
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.76
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.73
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 97.72
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 97.7
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 97.68
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.67
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 97.66
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 97.63
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.61
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 97.6
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.59
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 97.58
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 97.57
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.49
2laa_A104 Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Pa 97.43
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 97.41
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 97.32
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 97.3
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.29
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.26
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.13
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 97.02
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 97.01
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 96.9
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.89
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.88
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.83
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.79
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.76
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 96.57
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 96.55
2xxa_A433 Signal recognition particle protein; protein trans 96.5
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.45
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 96.41
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 96.37
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.33
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.29
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.29
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.28
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 96.27
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.27
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.21
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.2
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 96.15
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.14
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.12
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.01
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 96.01
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.95
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.86
3bos_A242 Putative DNA replication factor; P-loop containing 95.85
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.84
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 95.84
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 95.83
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.83
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.82
1xjc_A169 MOBB protein homolog; structural genomics, midwest 95.79
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.76
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 95.76
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 95.72
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 95.66
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.65
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.64
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 95.57
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 95.52
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 95.5
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.47
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.41
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 95.41
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.31
1u94_A356 RECA protein, recombinase A; homologous recombinat 95.3
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 95.29
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.27
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 95.27
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.22
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 95.21
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.14
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.13
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.09
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 95.07
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.03
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.02
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 95.0
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 94.99
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 94.97
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.95
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 94.91
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.9
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.84
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.83
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 94.8
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 94.78
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 94.77
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.65
2og2_A359 Putative signal recognition particle receptor; nuc 94.62
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 94.6
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 94.59
3czp_A 500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 94.57
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 94.55
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 94.54
3czq_A304 Putative polyphosphate kinase 2; structural genomi 94.48
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.45
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 94.44
3rhf_A289 Putative polyphosphate kinase 2 family protein; PS 94.44
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.41
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.41
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.37
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.34
1nd6_A 354 Prostatic acid phosphatase; PAP, prostate, phospha 94.29
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.28
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 94.28
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 94.21
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 94.11
3pvs_A447 Replication-associated recombination protein A; ma 94.1
2qgz_A308 Helicase loader, putative primosome component; str 93.93
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.92
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.9
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 93.89
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 93.89
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 93.87
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 93.87
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 93.81
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.73
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.73
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.71
3ntl_A 398 Acid glucose-1-phosphate phosphatase; histidine ac 93.69
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 93.64
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 93.6
2z43_A324 DNA repair and recombination protein RADA; archaea 93.58
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 93.58
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 93.57
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 93.48
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 93.47
1z0n_A96 5'-AMP-activated protein kinase, beta-1 subunit; b 93.36
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 93.29
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 93.22
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 93.17
2r62_A268 Cell division protease FTSH homolog; ATPase domain 93.16
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 93.14
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.13
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 93.11
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 93.11
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.11
1dkq_A 410 Phytase; histidine acid phosphatase fold, hydrolas 93.1
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 93.1
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 93.1
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 93.07
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 93.06
2www_A349 Methylmalonic aciduria type A protein, mitochondri 92.94
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 92.94
3it3_A 342 Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A 92.85
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 92.72
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 92.72
1tue_A212 Replication protein E1; helicase, replication, E1E 92.68
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 92.64
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 92.62
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 92.6
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 92.53
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 92.5
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 92.49
3zq6_A324 Putative arsenical pump-driving ATPase; tail-ancho 92.44
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 92.4
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 92.4
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.26
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 92.26
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 92.17
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 92.16
3ug7_A349 Arsenical pump-driving ATPase; tail-anchored, memb 92.13
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 92.07
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.07
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 92.04
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 91.99
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 91.98
4a74_A231 DNA repair and recombination protein RADA; hydrola 91.96
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 91.84
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 91.83
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 91.78
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 91.59
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 91.55
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 91.52
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 91.48
2hf9_A226 Probable hydrogenase nickel incorporation protein 91.43
2wnh_A 418 3-phytase; histidine acid phosphatase, hydrolase; 91.39
2woo_A329 ATPase GET3; tail-anchored, membrane protein, targ 91.37
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 91.29
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 91.22
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 91.16
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 91.15
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 91.06
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 91.06
2r44_A331 Uncharacterized protein; putative ATPase, structur 90.99
3end_A307 Light-independent protochlorophyllide reductase ir 90.93
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 90.9
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 90.85
2eyu_A261 Twitching motility protein PILT; pilus retraction 90.82
3iqw_A334 Tail-anchored protein targeting factor GET3; ATPas 90.8
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 90.74
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 90.7
3co5_A143 Putative two-component system transcriptional RES 90.66
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 90.65
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 90.59
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 90.58
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 90.42
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 90.39
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 90.38
3kjh_A254 CO dehydrogenase/acetyl-COA synthase complex, acce 90.32
2chq_A319 Replication factor C small subunit; DNA-binding pr 90.08
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 90.04
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 90.02
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 89.96
1nrj_B218 SR-beta, signal recognition particle receptor beta 89.96
3ea0_A245 ATPase, para family; alpha-beta-alpha sandwich, st 89.93
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-a 89.91
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, 89.71
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 89.68
1ojl_A304 Transcriptional regulatory protein ZRAR; response 89.68
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, st 89.61
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 89.6
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 89.52
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyro 89.48
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 89.44
2woj_A354 ATPase GET3; tail-anchored, membrane protein, targ 89.44
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iro 89.42
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 89.37
2wji_A165 Ferrous iron transport protein B homolog; membrane 89.33
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 89.29
1cp2_A269 CP2, nitrogenase iron protein; oxidoreductase; 1.9 89.27
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucle 89.26
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 89.21
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 89.21
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 89.08
3q9l_A260 Septum site-determining protein MIND; ATPase, bact 89.08
3cwq_A209 Para family chromosome partitioning protein; alpha 89.04
2ewv_A372 Twitching motility protein PILT; pilus retraction 89.02
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 89.0
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ 88.96
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 88.94
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 88.88
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 88.88
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 88.85
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 88.83
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 88.81
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 88.77
4aee_A696 Alpha amylase, catalytic region; hydrolase, hypert 88.69
3io3_A348 DEHA2D07832P; chaperone, membrane traffic, ATPase; 88.68
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 88.55
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, 88.47
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 88.44
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 88.38
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 88.35
2ged_A193 SR-beta, signal recognition particle receptor beta 88.34
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 88.19
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 88.16
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia 88.14
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 88.11
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 88.08
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 88.07
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 88.05
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 88.05
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 87.95
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 87.91
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 87.88
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 87.84
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 87.83
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 87.75
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 87.72
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 87.71
2oze_A298 ORF delta'; para, walker type atpases, DNA segrega 87.6
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 87.58
1qwo_A 442 Phytase; alpha barrel, beta sandwich, orthogonal b 87.35
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 87.24
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 87.09
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 87.07
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 87.05
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 87.01
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 87.0
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 86.99
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 86.96
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 86.94
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 86.94
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 86.94
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 86.93
3fkq_A373 NTRC-like two-domain protein; RER070207001320, str 86.92
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 86.9
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 86.8
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 86.8
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 86.8
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 86.77
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 86.73
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 86.69
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 86.68
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 86.63
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, 86.44
3ice_A422 Transcription termination factor RHO; transcriptio 86.42
2fna_A357 Conserved hypothetical protein; structural genomic 86.41
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 86.39
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chrom 86.39
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 86.38
2gno_A305 DNA polymerase III, gamma subunit-related protein; 86.33
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 86.32
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 86.25
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 86.33
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 86.23
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 86.21
1of1_A376 Thymidine kinase; transferase, antiviral drug, enz 86.2
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 86.17
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 86.05
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 86.01
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 85.94
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 85.93
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 85.84
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 85.83
3t1o_A198 Gliding protein MGLA; G domain containing protein, 85.81
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 85.72
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 85.69
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 85.67
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 85.66
3lxw_A247 GTPase IMAP family member 1; immunity, structural 85.66
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 85.64
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-lig 85.64
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 85.62
3kta_A182 Chromosome segregation protein SMC; structural mai 85.61
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 85.57
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 85.57
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 85.56
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 85.52
3lxx_A239 GTPase IMAP family member 4; structural genomics c 85.49
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 85.45
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 85.44
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 85.43
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 85.39
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 85.38
1b0u_A262 Histidine permease; ABC transporter, transport pro 85.38
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 85.36
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 85.3
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 85.29
1p9r_A418 General secretion pathway protein E; bacterial typ 85.28
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 85.25
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 85.18
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 85.18
2xj4_A286 MIPZ; replication, cell division, ATPase, WACA; 1. 85.13
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 85.12
2fh5_B214 SR-beta, signal recognition particle receptor beta 85.07
3k4q_A 444 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hex 85.03
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 85.03
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 85.02
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 84.99
2ghi_A260 Transport protein; multidrug resistance protein, M 84.98
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 84.95
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 84.93
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 84.9
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 84.86
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 84.85
1ji0_A240 ABC transporter; ATP binding protein, structural g 84.82
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 84.78
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 84.76
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 84.74
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 84.71
1g6h_A257 High-affinity branched-chain amino acid transport 84.69
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 84.66
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 84.59
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 84.53
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 84.48
1e2k_A331 Thymidine kinase; transferase, antiviral drug, enz 84.44
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 84.42
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 84.42
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 84.34
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 84.34
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 84.29
1kjw_A295 Postsynaptic density protein 95; protein-protein i 84.27
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 84.14
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 84.08
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 83.99
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 83.94
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 83.93
1sgw_A214 Putative ABC transporter; structural genomics, P p 83.88
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
Probab=100.00  E-value=7.2e-62  Score=550.75  Aligned_cols=339  Identities=45%  Similarity=0.817  Sum_probs=317.1

Q ss_pred             CccEEEEEEccCCCChhHHHHHHHHHHhhcCCCceEeehhhHHHHhhCCCCCCCCcCCCCHHHHHHHHHHHHHHHHHHHH
Q 005369          349 HRHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARNEVAALAMEDMIS  428 (699)
Q Consensus       349 ~~~~lIvmvGLPGSGKSTlAr~La~~L~~~gi~tdv~~~gdyRr~~~g~~~~~~f~~~~~~~~~~~~~~vA~~~l~dl~~  428 (699)
                      ..|.+|+|+|+|||||||+|++|+++|+|.++++++|+.|++|+...+.....+||.+.+++.++.+++++..+++++..
T Consensus        33 ~~~~lIvlvGlpGSGKSTia~~La~~L~~~~~d~~v~s~D~~r~~~~~~~~~~~~f~~~~~~~~~~re~~~~~~l~~~~~  112 (520)
T 2axn_A           33 NSPTVIVMVGLPARGKTYISKKLTRYLNWIGVPTKVFNVGEYRREAVKQYSSYNFFRPDNEEAMKVRKQCALAALRDVKS  112 (520)
T ss_dssp             CCCEEEEEECCTTSSHHHHHHHHHHHHHHTTCCEEEEEHHHHHHHHHSCCCCGGGGCTTCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCeEEEEECCCCCCHHHHHHHHHHHHhhcCCCeEEecccHHHHHhccCCccccccCcccHHHHHHHHHHHHHHHHHHHH
Confidence            46889999999999999999999999999999999999999999887765556888888999999999999999999999


Q ss_pred             HHh-cCCeEEEEeCCCCCHHHHHHHHHH-HcCCceEEEEEEEeCCHHHHHHHHHHhhccCCCCCCCCChHHHHHHHHHHH
Q 005369          429 WMH-EGGQVGIFDATNSSRKRRNMLMKM-AEGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRL  506 (699)
Q Consensus       429 ~L~-~~G~vVIlDAtn~~~e~R~~l~el-~~~~~~vifIE~~c~d~e~i~rrI~~r~~~spD~s~~~d~e~al~d~~~Ri  506 (699)
                      +|. +.|.+||+|+||.+++.|+.++++ .+.+++++||++.|++++++++|+.+++..+|+|.+. ++++++++|.+|+
T Consensus       113 ~L~~~~g~~VIvDat~~~~~~R~~~~~~a~~~g~~v~~l~~~~~d~e~i~~ri~~r~~~rPdl~~~-d~e~~~~~~~~Ri  191 (520)
T 2axn_A          113 YLAKEGGQIAVFDATNTTRERRHMILHFAKENDFKAFFIESVCDDPTVVASNIMEVKISSPDYKDC-NSAEAMDDFMKRI  191 (520)
T ss_dssp             HHHHSCCCEEEEESCCCSHHHHHHHHHHHHHHTCEEEEEEEECCCHHHHHHHHHHHTTTSGGGTTS-CHHHHHHHHHHHH
T ss_pred             HHHhcCCceEEecCCCCCHHHHHHHHHHHHHcCCeEEEEEEeCChHHHHHHHHHhhhhcCCccccC-CHHHHHHHHHHHH
Confidence            985 569999999999999999999988 6678899999999999999999998887778999998 8999999999999


Q ss_pred             HhhhhhccCCCCC------CceEEeecccCCcceeEEeccccCCCcceeeeecccCCCCcceEEecccccccccCCcccC
Q 005369          507 ANYEKVYEPVDEG------SYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPRPILLTRHGESRDNVRGRIGG  580 (699)
Q Consensus       507 ~~y~~~yEpl~e~------~yik~in~~~~~g~~~~~n~i~gyL~~rIvffLmN~~~~~~~I~LVRHGeS~~N~~~~~~G  580 (699)
                      +.|++.|||++++      +|||+||+    |+++++|+++|||+++|+|||||+|.++++||||||||+.+|..++++|
T Consensus       192 ~~y~~~Yepi~~ee~~~dl~yik~id~----g~~~~~~~~~g~l~~~~~~~l~n~~~~~~~i~LvRHGet~~n~~~~~~g  267 (520)
T 2axn_A          192 SCYEASYQPLDPDKCDRDLSLIKVIDV----GRRFLVNRVQDHIQSRIVYYLMNIHVQPRTIYLCRHGENEHNLQGRIGG  267 (520)
T ss_dssp             HHHHTTCCCCCTTTTTTTSEEEEEETT----TTEEEEECCCSHHHHHHHHHHTTCCCSCCCEEEEECCCBHHHHHTBCSS
T ss_pred             HhhhhhhcccChhhcccCcceEEEEcC----ccccccCCCCCCcchhhhhhhcccCCCceeEEEeecceeccccCCccCC
Confidence            9999999999832      89999999    9999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHhccCCCCEEEEcChHHHHHHHhhhcCCCccccccccccccCcCCCCCHHHHHHhCHHH
Q 005369          581 DTILSDAGEIYAKKLANFVEKRLKSERAASIWTSTLQRTILTASPIAGFPKIQWRALDEINAGVCDGMTYEEIKKNMPEE  660 (699)
Q Consensus       581 D~pLTe~G~~QA~~La~~L~~~l~~~~~~~V~sSpL~RA~QTA~~i~g~~v~~~~~L~E~~~G~~eG~t~~ei~~~~P~~  660 (699)
                      |.+||+.|++||+.++++|...  ...++.|||||+.||+|||+++ +.++.+++.|+|+++|.|+|++++++.++||+.
T Consensus       268 D~pLt~~G~~qA~~l~~~L~~~--~~~~~~v~sSpl~Ra~qTA~~i-~~~~~~~~~L~E~~~G~~eG~~~~ei~~~~p~~  344 (520)
T 2axn_A          268 DSGLSSRGKKFASALSKFVEEQ--NLKDLRVWTSQLKSTIQTAEAL-RLPYEQWKALNEIDAGVCEELTYEEIRDTYPEE  344 (520)
T ss_dssp             CCCBCHHHHHHHHHHHHHHHHH--CCSCCEEEECSSHHHHHHHHTT-TSCEEECGGGSCCCCGGGTTCBHHHHHHHCHHH
T ss_pred             CcccCHHHHHHHHHHHHHHHhc--CCCCCeEEeCCcHHHHHHHHHh-CCCcEEccccccccCCcccCCcHHHHHHHCHHH
Confidence            9999999999999999999876  5567899999999999999998 788899999999999999999999999999999


Q ss_pred             HHHHHhCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q 005369          661 YEARKKDKLRYRYPRGESYLDVIQRFAACPCSIWC  695 (699)
Q Consensus       661 ~~~~~~d~~~~~~PgGES~~dv~~Rv~~~L~~L~~  695 (699)
                      +..|..+++.+++|+|||+.++.+|+.++|++|..
T Consensus       345 ~~~~~~d~~~~~~p~gEs~~~~~~Rv~~~l~~l~~  379 (520)
T 2axn_A          345 YALREQDKYYYRYPTGESYQDLVQRLEPVIMELER  379 (520)
T ss_dssp             HHHHHHCTTTCCCTTSCCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhcCcccCCCCCCCCHHHHHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999854
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1fzt_A Phosphoglycerate mutase; open B-sheet-helices, isomerase; NMR {Schizosaccharomyces pombe} SCOP: c.60.1.1 Back     alignment and structure
>1h2e_A Phosphatase, YHFR; hydrolase, broad specificity phosphatase, DPGM homolog; 1.69A {Bacillus stearothermophilus} SCOP: c.60.1.1 PDB: 1h2f_A* 1ebb_A Back     alignment and structure
>2a6p_A Possible phosphoglycerate mutase GPM2; predicted phosphoglycerate mutase, structural genomics, PSI, structure initiative; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>3kkk_A Phosphoglycerate mutase; PGAM, glycolysis, malaria, structural genomics, medical STRU genomics of pathogenic protozoa, MSGPP; 2.08A {Plasmodium falciparum 3D7} PDB: 1xq9_A Back     alignment and structure
>1e58_A Phosphoglycerate mutase; phosphohistidine, glycolysis and gluconeogenesis, isomerase; HET: NEP; 1.25A {Escherichia coli} SCOP: c.60.1.1 PDB: 1e59_A* Back     alignment and structure
>3hjg_A Putative alpha-ribazole-5'-phosphate phosphatase COBC; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.80A {Vibrio parahaemolyticus} Back     alignment and structure
>1yfk_A Phosphoglycerate mutase 1; alpha/beta, isomerase, hydrolase; HET: CIT; 2.70A {Homo sapiens} PDB: 1yjx_A* Back     alignment and structure
>3d8h_A Glycolytic phosphoglycerate mutase; structural genomics, malaria, glycolysis, I structural genomics consortium, SGC; 2.01A {Cryptosporidium parvum} Back     alignment and structure
>2hhj_A Bisphosphoglycerate mutase; isomerase; HET: NEP DG2 3PG; 1.50A {Homo sapiens} SCOP: c.60.1.1 PDB: 1t8p_A* 2f90_A* 2a9j_A* 2h4z_A* 2h52_A* 2h4x_A* 3nfy_A Back     alignment and structure
>3gp3_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyceromutase, decode, SBRI, niaid, UWPPG, glycolysis isomerase; HET: PG4 SEP; 1.50A {Burkholderia pseudomallei} SCOP: c.60.1.1 PDB: 3fdz_A* 3ezn_A* 3gp5_A* 3gw8_A* 3lnt_A Back     alignment and structure
>1qhf_A Protein (phosphoglycerate mutase); transferase (phosphoryl); HET: 3PG; 1.70A {Saccharomyces cerevisiae} SCOP: c.60.1.1 PDB: 5pgm_D 1bq3_D* 1bq4_D 4pgm_A 3pgm_A* Back     alignment and structure
>4emb_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.30A {Borrelia burgdorferi} Back     alignment and structure
>1rii_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; phosphoglyerate mutase, SH3 domain binding, structural genom TBSGC; 1.70A {Mycobacterium tuberculosis} SCOP: c.60.1.1 Back     alignment and structure
>4eo9_A 2,3-bisphosphoglycerate-dependent phosphoglycerat; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.45A {Mycobacterium leprae} Back     alignment and structure
>2qni_A AGR_C_517P, uncharacterized protein ATU0299; MCSG, in SITU proteolysis, structural genomics, PSI protein structure initiative; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dcy_A Regulator protein; OMIM 610775, C12ORF5, tigar, TP53-induced glycolysis and apoptosis regulator, CAsp target, structural genomics medical relevance; HET: MSE; 1.75A {Homo sapiens} Back     alignment and structure
>3e9c_A ZGC:56074; histidine phosphatase, hydrolase; 2.00A {Danio rerio} PDB: 3e9d_A 3e9e_A Back     alignment and structure
>1v37_A Phosphoglycerate mutase; riken structu genomics/proteomics initiative, RSGI, structural genomics,; 1.40A {Thermus thermophilus} SCOP: c.60.1.1 PDB: 1v7q_A 2hia_A 2pa0_A 2p2y_A 2p77_A 2p6m_A 2p9y_A 2p30_A 2ekz_A 2p9f_A 2p79_A 2p78_A 2p2z_A 2p75_A 2owe_A 2enu_A 2ekb_A 2p6o_A 2owd_A 2enw_A ... Back     alignment and structure
>3f3k_A Uncharacterized protein YKR043C; structural genomics,, PSI-2, prote structure initiative; 1.75A {Saccharomyces cerevisiae} PDB: 3lg2_A 3oi7_A* 3ll4_A* Back     alignment and structure
>3r7a_A Phosphoglycerate mutase, putative; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE EPE; 1.84A {Bacillus anthracis} Back     alignment and structure
>3d4i_A STS-2 protein; PGM, 2H-phosphatase, PTP, SH3 domain, hydrolase; 1.95A {Mus musculus} PDB: 3d6a_A 3db1_A Back     alignment and structure
>3c7t_A Ecdysteroid-phosphate phosphatase; ecdysone, 2H-phosphatase, PGM, hydrolase; 1.76A {Bombyx mori} Back     alignment and structure
>3mbk_A Ubiquitin-associated and SH3 domain-containing PR; PGM, STS-1, signaling protein, low PH, alternative splicing, cytoplasm, nucleus, phosphoprotein; 1.35A {Mus musculus} PDB: 2ikq_A 2h0q_A Back     alignment and structure
>3eoz_A Putative phosphoglycerate mutase; PGAM, malaria, structural genomics, isomerase, structural GE consortium, SGC; 2.40A {Plasmodium falciparum} Back     alignment and structure
>3mxo_A Serine/threonine-protein phosphatase PGAM5, mitoc; phosphoglycerate mutase family member 5, BXLBV68, MGC protein, structural genomics consortium; HET: PG4 PGE PEG; 1.70A {Homo sapiens} PDB: 3o0t_A Back     alignment and structure
>2z0b_A GDE5, KIAA1434, putative glycerophosphodiester phosphodiesterase; CBM20 domain, starch-binding, hydrolase, STR genomics, NPPSFA; 2.00A {Homo sapiens} Back     alignment and structure
>1ac0_A Glucoamylase; hydrolase, starch binding domain; HET: GLC BGC GLO; NMR {Aspergillus niger} SCOP: b.3.1.1 PDB: 1acz_A* 1kul_A 1kum_A Back     alignment and structure
>1ujc_A Phosphohistidine phosphatase SIXA; alpha-beta fold, hydrolase; 1.90A {Escherichia coli} PDB: 1ujb_A Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>2rfl_A Putative phosphohistidine phosphatase SIXA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>2vn4_A Glucoamylase; hydrolase, carbohydrate binding, glycoside hydrolase family 15, amyloglucosidase; HET: MAN NAG BTB; 1.85A {Hypocrea jecorina} PDB: 2vn7_A* Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3f2i_A ALR0221 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG, function; 2.00A {Nostoc SP} Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4hbz_A Putative phosphohistidine phosphatase, SIXA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, HP_PGM_LIKE; HET: PGE; 1.55A {Nakamurella multipartita} Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2laa_A Beta/alpha-amylase; SBD, CBM25, hydrolase; NMR {Paenibacillus polymyxa} PDB: 2lab_A Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1nd6_A Prostatic acid phosphatase; PAP, prostate, phosphate, inhibi hydrolase; HET: NAG MAN 1PE; 2.40A {Homo sapiens} SCOP: c.60.1.2 PDB: 1nd5_A* 2hpa_A* 1cvi_A* 1rpa_A* 1rpt_A* 2l3h_A 2l77_A 2l79_A Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3ntl_A Acid glucose-1-phosphate phosphatase; histidine acid phosphatase, phytate binding site, hydrolase; HET: IHP; 1.88A {Enterobacter cloacae} PDB: 1nt4_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1z0n_A 5'-AMP-activated protein kinase, beta-1 subunit; beta sandwich, sugar binding protein; HET: BCD; 1.49A {Rattus norvegicus} SCOP: b.1.18.21 PDB: 1z0m_A* 2f15_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1dkq_A Phytase; histidine acid phosphatase fold, hydrolase; HET: IHP; 2.05A {Escherichia coli} SCOP: c.60.1.2 PDB: 1dkp_A* 1dkm_A 1dkn_A 1dko_A 1dkl_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3it3_A Acid phosphatase; HAP, hydrolase; HET: 3AM; 1.50A {Francisella tularensis subsp} PDB: 4e3w_A 2glc_A 2glb_A 2gla_A 3it0_A* 3it1_A* 3it2_A 2p36_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2wnh_A 3-phytase; histidine acid phosphatase, hydrolase; 1.68A {Klebsiella pneumoniae} PDB: 2wni_A 2wu0_A Back     alignment and structure
>2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3ea0_A ATPase, para family; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: ATP; 2.20A {Chlorobium tepidum} Back     alignment and structure
>1g3q_A MIND ATPase, cell division inhibitor; alpha-beta-alpha layered, protein-ADP complex, cell cycle, hydrolase; HET: ADP; 2.00A {Pyrococcus furiosus} SCOP: c.37.1.10 PDB: 1g3r_A* 1ion_A* Back     alignment and structure
>3k9g_A PF-32 protein; ssgcid, SBRI, decode biostructures, UW, NIH, niaid, borellia burgdorferi, plasmid partition protein, iodide; 2.25A {Borrelia burgdorferi} PDB: 3k9h_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2ph1_A Nucleotide-binding protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Archaeoglobus fulgidus dsm 4304} PDB: 3kb1_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2woj_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; HET: ADP; 1.99A {Saccharomyces cerevisiae} PDB: 3h84_A 3zs8_A 3zs9_A* 3sja_A 3sjb_A 3sjc_A 3sjd_A* 3idq_A 3a36_A 3a37_A* Back     alignment and structure
>2afh_E Nitrogenase iron protein 1; nitrogen fixation, iron-sulfur, metal-binding, molybdenum, oxidoreductase; HET: HCA CFN CLF PGE PG4 P6G 1PE; 2.10A {Azotobacter vinelandii} SCOP: c.37.1.10 PDB: 1g1m_A 1g5p_A 1m1y_E* 1m34_E* 1n2c_E* 1nip_A* 1fp6_A* 2afi_E* 2afk_E* 2nip_A 1de0_A 1xcp_A* 1xdb_A 1xd8_A 1xd9_A* 1g20_E* 1g21_E* 2c8v_A* 1rw4_A Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1cp2_A CP2, nitrogenase iron protein; oxidoreductase; 1.93A {Clostridium pasteurianum} SCOP: c.37.1.10 Back     alignment and structure
>3la6_A Tyrosine-protein kinase WZC; P-loop protein, nucleotide binding domain, walker A motif, B protein kinase, oligomerization; HET: ADP; 3.20A {Escherichia coli} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3q9l_A Septum site-determining protein MIND; ATPase, bacterial cell division inhibitor, MINC, MINE, cell hydrolase; HET: ATP; 2.34A {Escherichia coli} PDB: 3r9i_A* 3r9j_A* Back     alignment and structure
>3cwq_A Para family chromosome partitioning protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: ADP; 2.47A {Synechocystis SP} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1hyq_A MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bacterial cell division, cell cycle; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.10 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>3io3_A DEHA2D07832P; chaperone, membrane traffic, ATPase; HET: ADP; 1.80A {Debaryomyces hansenii} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1qwo_A Phytase; alpha barrel, beta sandwich, orthogonal bundle, glycoprotein phosphohistidine, hydrolase; HET: NEP NAG; 1.50A {Aspergillus fumigatus} SCOP: c.60.1.2 PDB: 1skb_A* 1sk8_A* 1ska_A* 1sk9_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1wcv_1 SOJ, segregation protein; ATPase, bacterial, chromosome segregation; 1.6A {Thermus thermophilus} PDB: 2bej_A* 2bek_A* Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1byi_A Dethiobiotin synthase; biotin synthesis, cyclo-ligase, ligase; 0.97A {Escherichia coli} SCOP: c.37.1.10 PDB: 1bs1_A* 1a82_A 1dad_A* 1dae_A* 1daf_A* 1dag_A* 1dah_A* 1dai_A* 1dak_A* 1dam_A* 1dbs_A 1dts_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2xj4_A MIPZ; replication, cell division, ATPase, WACA; 1.60A {Caulobacter vibrioides} PDB: 2xj9_A* 2xit_A Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3k4q_A 3-phytase A; PHYA, 3-phosphotase, MYO-inositol hexakis phosphate phosphohydrolase, 37288-11-2, MYO-inositol hexakis sulfate, 62-1; HET: IHS NAG; 2.20A {Aspergillus niger} SCOP: c.60.1.2 PDB: 3k4p_A* 1ihp_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 699
d1bifa1213 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fruct 2e-43
d1fzta_211 c.60.1.1 (A:) Phosphoglycerate mutase {Fission yea 1e-17
d1e58a_247 c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia 2e-15
d1bifa2219 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fruc 4e-13
d1xq9a_241 c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium 6e-12
d1riia_243 c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacteri 6e-10
d1h2ea_207 c.60.1.1 (A:) Broad specificity phosphatase PhoE ( 9e-10
d1cyga2106 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransfera 4e-09
d3bmva2105 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransfera 5e-09
d1qhfa_240 c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yea 2e-08
d2hhja1 248 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human 5e-08
d1kula_108 b.3.1.1 (A:) Glucoamylase, granular starch-binding 6e-08
d1qhoa2110 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransfera 9e-08
d1khta_190 c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco 2e-07
d1nksa_194 c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu 8e-07
d1vema199 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus 1e-06
d1v37a_171 c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphat 3e-06
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 1e-05
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 5e-05
d1m8pa3183 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d 1e-04
d1x6va3195 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kin 1e-04
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 2e-04
d1j8yf2211 c.37.1.10 (F:87-297) GTPase domain of the signal s 2e-04
d2cdna1181 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium 0.001
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 0.003
d1qf9a_194 c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi 0.003
d1okkd2207 c.37.1.10 (D:97-303) GTPase domain of the signal r 0.004
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 0.004
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 213 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
domain: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  153 bits (387), Expect = 2e-43
 Identities = 86/214 (40%), Positives = 129/214 (60%), Gaps = 12/214 (5%)

Query: 354 IVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGME 413
           IV+VGLPARGKT+ + KLTRYL ++G  T+ FNVG+YRR      +S +FF  DN EG++
Sbjct: 5   IVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEEGLK 64

Query: 414 ARNEVAALAMEDMISW-MHEGGQVGIFDATNSSRKRRNMLMKMA-EGNCKIIFLETICND 471
            R + A  A+ D+  +   EGG V +FDATN++R+RR M+     +   K  F+E+IC D
Sbjct: 65  IRKQCALAALNDVRKFLSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVD 124

Query: 472 RDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLANYEKVYEPVDEG-----SYIKMID 526
            ++I  NI  +++         D +   +DF  R+  YE  YE +DE      SYIK++D
Sbjct: 125 PEVIAANIV-QVKLGSPDYVNRDSDEATEDFMRRIECYENSYESLDEEQDRDLSYIKIMD 183

Query: 527 MVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPR 560
           +    G    VN ++ ++  RIV++L+N H+TPR
Sbjct: 184 V----GQSYVVNRVADHIQSRIVYYLMNIHVTPR 213
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 211 Back     information, alignment and structure
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 219 Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 243 Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Length = 207 Back     information, alignment and structure
>d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 106 Back     information, alignment and structure
>d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]} Length = 105 Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 240 Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1kula_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]} Length = 108 Back     information, alignment and structure
>d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Length = 110 Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190 Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194 Back     information, alignment and structure
>d1vema1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} Length = 99 Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Length = 195 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 211 Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 181 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194 Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Length = 207 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query699
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 100.0
d1fzta_211 Phosphoglycerate mutase {Fission yeast (Schizosacc 99.94
d1h2ea_207 Broad specificity phosphatase PhoE (YhfR) {Bacillu 99.94
d1bifa2219 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.94
d1e58a_247 Phosphoglycerate mutase {Escherichia coli [TaxId: 99.93
d1v37a_171 Alpha-ribazole-5'-phosphate phosphatase {Thermus t 99.91
d1riia_243 Phosphoglycerate mutase {Mycobacterium tuberculosi 99.91
d1xq9a_241 Phosphoglycerate mutase {Plasmodium falciparum [Ta 99.9
d2hhja1248 Phosphoglycerate mutase {Human (Homo sapiens) [Tax 99.89
d1qhfa_240 Phosphoglycerate mutase {Baker's yeast (Saccharomy 99.86
d3bmva2105 Cyclodextrin glycosyltransferase, C-terminal domai 99.77
d1cyga2106 Cyclodextrin glycosyltransferase, C-terminal domai 99.73
d1qhoa2110 Cyclodextrin glycosyltransferase, C-terminal domai 99.7
d1kula_108 Glucoamylase, granular starch-binding domain {Aspe 99.64
d1vema199 beta-amylase {Bacillus cereus [TaxId: 1396]} 99.64
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 99.59
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 99.46
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 99.45
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 99.27
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 99.25
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 99.18
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.18
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 99.06
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 99.02
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 99.0
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.94
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.89
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.81
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.75
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 98.73
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.71
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 98.64
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.61
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.57
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.52
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.51
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 98.49
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.47
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 98.47
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.39
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.35
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 98.34
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 98.32
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.32
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 98.29
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.19
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 98.17
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.13
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 97.96
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.85
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.75
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.72
d2qy9a2211 GTPase domain of the signal recognition particle r 97.65
d1vmaa2213 GTPase domain of the signal recognition particle r 97.64
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.62
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 97.61
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 97.52
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.51
d1okkd2207 GTPase domain of the signal recognition particle r 97.46
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.45
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.44
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.41
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.38
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 97.22
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 97.2
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 97.13
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.04
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.95
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.93
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.83
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.79
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.72
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.69
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 96.65
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 96.62
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.52
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.52
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.48
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.46
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.45
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.22
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.13
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.01
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.92
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 95.85
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.7
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.65
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 95.61
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.61
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 95.48
d1nd6a_ 342 Prostatic acid phosphatase {Human (Homo sapiens) [ 95.37
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.34
d1qwoa_ 435 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 95.3
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 95.23
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.16
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.12
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.86
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 94.7
d1nt4a_ 391 Glucose-1-phosphatase {Escherichia coli [TaxId: 56 94.64
d1ihpa_ 438 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 94.55
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.45
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.44
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.41
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.3
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.29
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.2
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.18
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.14
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.1
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 94.07
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.96
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 93.87
d1dkla_ 409 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 93.85
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.84
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 93.75
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.59
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 93.54
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.42
d1svma_362 Papillomavirus large T antigen helicase domain {Si 93.4
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 93.25
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 93.03
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.95
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 92.89
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 92.85
d2qlvb187 SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} 92.8
d2hyda1255 Putative multidrug export ATP-binding/permease pro 92.79
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 92.65
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 92.53
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.28
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 92.17
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.16
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 92.02
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 91.62
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 91.34
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 91.32
d1qfxa_ 447 Phytase (myo-inositol-hexakisphosphate-3-phosphohy 91.32
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 91.11
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 90.83
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.7
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 90.57
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 90.41
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 90.4
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 90.4
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 90.34
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 90.3
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 90.23
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 89.96
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 89.92
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 89.61
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 89.41
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 89.32
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 89.31
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 89.28
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.23
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 89.16
d1m7xa1110 1,4-alpha-glucan branching enzyme, N-terminal doma 88.97
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 88.87
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 88.78
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 88.71
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 88.35
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.22
d1nrjb_209 Signal recognition particle receptor beta-subunit 88.2
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 87.9
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 87.87
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 87.85
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.8
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 87.74
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 87.7
d2fh5b1207 Signal recognition particle receptor beta-subunit 87.67
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 87.65
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.65
d1z0na187 5'-AMP-activated protein kinase subunit beta-1 {Ra 87.54
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 87.5
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 87.19
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 87.19
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 87.07
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 86.98
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 86.92
d1g2912240 Maltose transport protein MalK, N-terminal domain 86.9
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 86.88
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 86.8
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 86.79
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 86.78
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 86.77
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 86.56
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 86.39
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 86.3
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 86.0
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 85.9
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 85.88
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 85.81
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 85.69
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 85.68
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.59
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 85.51
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.51
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 85.45
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 85.35
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 85.26
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 85.23
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 85.22
d2awna2232 Maltose transport protein MalK, N-terminal domain 85.06
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 84.81
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 84.77
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 84.66
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 84.61
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 84.54
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 84.39
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 84.34
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.16
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 83.97
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 83.95
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 83.87
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 83.68
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 83.66
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 83.58
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 83.56
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 83.56
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 83.55
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 83.24
d1tuea_205 Replication protein E1 helicase domain {Human papi 83.13
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 82.83
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 82.71
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 82.63
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 82.61
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 82.53
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 82.33
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 82.29
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 82.16
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 82.02
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 81.89
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 81.75
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 81.75
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 81.57
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 81.49
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 81.21
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 80.8
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 80.73
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 80.66
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 80.62
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 80.52
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 80.21
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
domain: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=3.8e-33  Score=272.09  Aligned_cols=206  Identities=44%  Similarity=0.773  Sum_probs=190.2

Q ss_pred             ccEEEEEEccCCCChhHHHHHHHHHHhhcCCCceEeehhhHHHHhhCCCCCCCCcCCCCHHHHHHHHHHHHHHHHHHHHH
Q 005369          350 RHLAIVLVGLPARGKTFTAAKLTRYLRWLGHDTKHFNVGKYRRLKHGVNQSADFFRADNPEGMEARNEVAALAMEDMISW  429 (699)
Q Consensus       350 ~~~lIvmvGLPGSGKSTlAr~La~~L~~~gi~tdv~~~gdyRr~~~g~~~~~~f~~~~~~~~~~~~~~vA~~~l~dl~~~  429 (699)
                      +|+||+|+|+|||||||+|++|+++|+|.+.++.+++.|++|+...+......++...+........+++..+++++..+
T Consensus         1 ~p~li~l~GlpgsGKSTla~~L~~~l~~~~~~~~~~~~D~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (213)
T d1bifa1           1 CPTLIVMVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRDMVKTYKSFEFFLPDNEEGLKIRKQCALAALNDVRKF   80 (213)
T ss_dssp             CCEEEEEECCTTSSHHHHHHHHHHHHHHTTCCEEEEEHHHHHHHHHCSCCCGGGGCTTCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHhcCCCCeEEcccceehhhccccccccccccccccchhhHHHHHHHHHHHHHHH
Confidence            58999999999999999999999999999999999999999998887777777777788888888889999888888888


Q ss_pred             Hh-cCCeEEEEeCCCCCHHHHHHHHHH-HcCCceEEEEEEEeCCHHHHHHHHHHhhccCCCCCCCCChHHHHHHHHHHHH
Q 005369          430 MH-EGGQVGIFDATNSSRKRRNMLMKM-AEGNCKIIFLETICNDRDIIERNIRLKIQQSPDYAEEPDFEAGLQDFKNRLA  507 (699)
Q Consensus       430 L~-~~G~vVIlDAtn~~~e~R~~l~el-~~~~~~vifIE~~c~d~e~i~rrI~~r~~~spD~s~~~d~e~al~d~~~Ri~  507 (699)
                      +. ++|.+||+|++|.++++|+.+.++ .+.+..++|+++.|++++++++|+...+...+++.+. +...+.++|.+|+.
T Consensus        81 ~~~~~~~~vi~d~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~l~  159 (213)
T d1bifa1          81 LSEEGGHVAVFDATNTTRERRAMIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYVNR-DSDEATEDFMRRIE  159 (213)
T ss_dssp             HHTTCCSEEEEESCCCSHHHHHHHHHHHHHHTCEEEEEEECCCCHHHHHHHHHHHTTTSTTTTTS-CHHHHHHHHHHHHH
T ss_pred             HHhcCCCEEEeecCCccHHHHHHHHHHHHhcCCeEEEEEeeccHHHHHHHhHHHHhcCCCccccc-chHHHHHHHHHhhh
Confidence            76 458899999999999999999998 7788999999999999999999998888888999998 99999999999999


Q ss_pred             hhhhhccCCCCC-----CceEEeecccCCcceeEEeccccCCCcceeeeecccCCCCc
Q 005369          508 NYEKVYEPVDEG-----SYIKMIDMVSGHGGQIQVNNISGYLPGRIVFFLVNTHLTPR  560 (699)
Q Consensus       508 ~y~~~yEpl~e~-----~yik~in~~~~~g~~~~~n~i~gyL~~rIvffLmN~~~~~~  560 (699)
                      .+.+.|||+++.     +||+.+|+    |+++++|+|.|||++|++|||||+|.+++
T Consensus       160 ~~~~~~e~~~~~~~~~~~~I~~~n~----g~~~lvn~i~g~l~~riv~~l~n~~~~~~  213 (213)
T d1bifa1         160 CYENSYESLDEEQDRDLSYIKIMDV----GQSYVVNRVADHIQSRIVYYLMNIHVTPR  213 (213)
T ss_dssp             HHHTTCCCCCTTTTTTSCEEEEETT----TTEEEEECCCSHHHHHHHHHHTTCCCCCC
T ss_pred             hccccccccCccccCCcCeEecCCC----CceeeecccccccHHHHHHHhhhcCcCCC
Confidence            999999999864     89999999    99999999999999999999999998764
>d1fzta_ c.60.1.1 (A:) Phosphoglycerate mutase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e58a_ c.60.1.1 (A:) Phosphoglycerate mutase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v37a_ c.60.1.1 (A:) Alpha-ribazole-5'-phosphate phosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1riia_ c.60.1.1 (A:) Phosphoglycerate mutase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xq9a_ c.60.1.1 (A:) Phosphoglycerate mutase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hhja1 c.60.1.1 (A:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhfa_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3bmva2 b.3.1.1 (A:579-683) Cyclodextrin glycosyltransferase, C-terminal domain {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qhoa2 b.3.1.1 (A:577-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1kula_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1vema1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1nd6a_ c.60.1.2 (A:) Prostatic acid phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qwoa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1nt4a_ c.60.1.2 (A:) Glucose-1-phosphatase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihpa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus ficuum [TaxId: 5058]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1dkla_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qlvb1 b.1.18.21 (B:161-247) SIP2 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfxa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1m7xa1 b.1.18.2 (A:117-226) 1,4-alpha-glucan branching enzyme, N-terminal domain N {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1z0na1 b.1.18.21 (A:77-163) 5'-AMP-activated protein kinase subunit beta-1 {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure