Citrus Sinensis ID: 005389


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------70
MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNPELYYFLLICSTN
ccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHcccccccccccccccccEEEEcccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEECccccccccHHHHHHHHHcccccccEEEEEcccccccccccHHHHHccccccccccEEEEEcccHHHHcccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcc
*********************GGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQA**********GVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQI******************************************************************************************************************************VEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNPELYYFLLICSTN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADEPATNTTAAQSQPSAVPLGGSVIPLVNKLQDIFAQLGSQSTIELPQVAVVGSQSSGKSSVLEALVGRDFLPRGNDICTRRPLVLQLLQTKTDEEYGEFLHLPGKRFYDFSEIRREIQAQTDKEAGGNKGVSDKQIRLKIFSPHVLDITLVDLPGITKVPVGEQPADIEARIRTMIMSYIKQPSCLILAVTPANSDLANSDALQIAGIADPDGYRTIGIITKLDIMDRGTDARNLLLGKVIPLRLGYVGVVNRSQEDIMFNRSIKDALVAEEKFFRSRPVYNGLADRCGVPQLAKKLNQILVQHIKAILPGLKSRISSALVSVAKEHASYGEITESKAGQGALLLNILSKYSEAFSSMVEGKNEEMSTSELSGGARIHYIFQSIFVKSLEEVDPCEDLTDDDIRTAIQNATGPKSALFVPDVPFEVLIRRQIARLLDPSLQCARFIYDELMKISHHCLVNELQRFPVLRKRMDEVIGNFLREGLEPSETMIGHIIEMEMDYINTSHPNFIGGSKAVEIALQQIKSSKVPLPITRHKDGVEPDKAPSSERSLKSRAILARQVNGIMADQGVRPTVEVEKVAPAGNTSGSSWGISSIFGGSDNRVPAGKESVTNKPFSEPVQNVEHAFAMIHLREPPTILRPSESHSEQENVEIAVTKLLLRSYYDIVRKNIEDSIPKAVMHFLVNPELYYFLLICSTN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynamin-related protein 3A Involved in the control of mitochondrial division and morphology.confidentQ8S944
Dynamin-related protein DNM1 Microtubule-associated force-producing protein that participates mitochondrial fission. Fission of mitochondria occurs in many cell types and constitutes an important step in mitochondria morphology, which is balanced between fusion and fission. Functions antagonistically with FZO1.probableP54861
Dynamin-1-like protein Functions in mitochondrial and peroxisomal division. Mediates membrane fission through oligomerization into ring-like structures which wrap around the scission site to constict and sever the mitochondrial membrane through a GTP hydrolysis-dependent mechanism. Required for normal brain development. Facilitates developmentally-regulated apoptosis during neural tube development. Required for a normal rate of cytochrome c release and caspase activation during apoptosis. Also required for mitochondrial fission during mitosis. May be involved in vesicle transport.probableQ2KIA5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AKA, chain B
Confidence level:very confident
Coverage over the Query: 22-322
View the alignment between query and template
View the model in PyMOL
Template: 3ZVR, chain A
Confidence level:very confident
Coverage over the Query: 21-514,551-695
View the alignment between query and template
View the model in PyMOL