Citrus Sinensis ID: 005426


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------
MEEDLLVSGEASGNNRNNDNNRRRRGPTALFRRRTDAITRGSPYQKAAALVDLKPLWCAKTGVGTYSCYDREYYYLGQLPYLTGWESLVYEGITLVILIIHTFFPITYEGSPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNIRQLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWLAYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQLAKQVSEMDRMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISREEFELIFDELDDTHDFKINLDEFADLCNAIALRFQKEDVPSCFENLPSIYHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTLDIQESSLQSVWQEVEFVFGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIRYLLLARMLRLIRLLMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFYLITVLLLLNLVIAFVLEAFFAEMELESSEKCEEEDKDGEPRERRRRVGTKTRSQKVDVLLHHMLSAELQKSCDS
ccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHcccccccEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccccEEEEEEHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHEEEEEECccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccHHHHHcHHHHHHHHcccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHcccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccHHHHHHHcccccccHHHHHHHHHHHHHHHHccccc
************************************AITRGSPYQKAAALVDLKPLWCAKTGVGTYSCYDREYYYLGQLPYLTGWESLVYEGITLVILIIHTFFPITYEGSPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNIRQLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWLAYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQLAKQVSEM*RMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISREEFELI**********KINLDEFADLCNAIALRFQKEDVPSCFENLPSIYHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTLDIQESSLQSVWQEVEFVFGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIRYLLLARMLRLIRLLMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFYLITVLLLLNLVIAFVLEAFFAE****************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxHxxxxxxHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxHHxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEDLLVSGEASGNNRNNDNNRRRRGPTALFRRRTDAITRGSPYQKAAALVDLKPLWCAKTGVGTYSCYDREYYYLGQLPYLTGWESLVYEGITLVILIIHTFFPITYEGSPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNIRQLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWLAYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQLAKQVSEMDRMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISREEFELIFDELDDTHDFKINLDEFADLCNAIALRFQKEDVPSCFENLPSIYHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTLDIQESSLQSVWQEVEFVFGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIRYLLLARMLRLIRLLMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQSYKELTGTAWTLAYFVSFYLITVLLLLNLVIAFVLEAFFAEMELESSEKCEEEDKDGEPRERRRRVGTKTRSQKVDVLLHHMLSAELQKSCDS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Two pore calcium channel protein 1 May function as one of the major voltage-gated Ca(2+) channel (VDCC) across the plasma membrane. May be involved in the regulation of cytosolic Ca(2+) and in growth and development. Acts as the major ROS-responsive Ca(2+) channel and is the possible target of Al-dependent inhibition. Determines sensitivity to T.viride xylanase elicitor. Plays a regulatory role in elicitor-induced defense responses and hypersensitive cell death.probableQ5QM84
Two pore calcium channel protein 1 Functions as a voltage-gated inward-rectifying Ca(2+) channel (VDCC) across the vacuole membrane. Is one of the essential components of the slow vacuolar (SV) channel. Acts as the major ROS-responsive Ca(2+) channel and is the possible target of Al-dependent inhibition. Involved in the regulation of germination and stomatal movement.probableQ94KI8
Two pore calcium channel protein 1 Functions as a voltage-gated inward-rectifying Ca(2+) channel (VDCC) across the plasma membrane that mediates sucrose-induced Ca(2+) influx in autotrophically grown leaf cells. Acts as the major ROS-responsive Ca(2+) channel and is the possible target of Al-dependent inhibition. Plays a regulatory role in defense responses.probableQ6YLX9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RVY, chain A
Confidence level:very confident
Coverage over the Query: 386-559,578-642
View the alignment between query and template
View the model in PyMOL
Template: 3RVY, chain A
Confidence level:very confident
Coverage over the Query: 31-133,144-275
View the alignment between query and template
View the model in PyMOL
Template: 2R9R, chain B
Confidence level:confident
Coverage over the Query: 25-281
View the alignment between query and template
View the model in PyMOL
Template: 2R9R, chain B
Confidence level:confident
Coverage over the Query: 383-557,576-650
View the alignment between query and template
View the model in PyMOL
Template: 2KGR, chain A
Confidence level:confident
Coverage over the Query: 291-365
View the alignment between query and template
View the model in PyMOL
Template: 2BE4, chain A
Confidence level:probable
Coverage over the Query: 271-393
View the alignment between query and template
View the model in PyMOL