Citrus Sinensis ID: 005523


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690--
MYSLPSQAMRPLSLSPCLTRSSYLRFRILSSLSLPPIFHNSQTRLSFSKNYTRPHLFIRNCTSITAKPSSEFNRNRTQDAPDEKLRALRELFSRPGVNIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTTFEWLNDVLAPGGRVGIDPFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVNAAIMNTYEIAIEKYLTSNNNKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAELEGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISGSGANGAIIHYKPEPGKCSVVDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLQGHIALDQAIFPQSTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLVEGMIVSNEPGYYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVPIQTKLVDLSLLSAAEIDWLNNYHSQVWEKVSKSR
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccEEEEccccccccccccccccccccccccccccCEEEEEcccEEEEEccHHHHHHHHHHcccEEEEEccccccccHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHcccEEEEccccccHHHHHccccccccccccEEEccccccccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHccccccccccccEEEEEEEEccEEEEEEccccccHHHHHHHHHcccEECcccHHHHHHHHHHHcccCEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEccccccccccccEEEEccEEEEEEccccccccccccEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccc
****************CLTRSSYLRFRILSSLSLPPIFHNSQTRLSFSKNYTRPHLFIRNCTSI********************LRALRELFSRPGVNIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTTFEWLNDVLAPGGRVGIDPFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVNAAIMNTYEIAIEKYLTSNNNKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAELEGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISGSGANGAIIHYKPEPGKCSVVDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLQGHIALDQAIFPQSTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLVEGMIVSNEPGYYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVPIQTKLVDLSLLSAAEIDWLNNYHSQVWEKVSK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYSLPSQAMRPLSLSPCLTRSSYLRFRILSSLSLPPIFHNSQTRLSFSKNYTRPHLFIRNCTSITAKPSSEFNRNRTQDAPDEKLRALRELFSRPGVNIDAYIIPSQDAHQSEFIAECYMRRAYISGFTGSAGTAVVTKDKAALWTDGRYFLQAEKQLSSSWILMRSGNHGVPTTFEWLNDVLAPGGRVGIDPFLFSSDAAEELKEAIAKKNHELVYLYDLNLVDVIWKESRPKPPNKPIRVHALKYAGLDVASKLSSLRSDLVDAGSSAIVISMLDEIAWLLNLRGSDVPHSPVMYAYLIVEMDRAKLFVDDSKVTPDVMDHLKNAGVELRPYNSILSEIKSLAAQGAQLWLDPSSVNAAIMNTYEIAIEKYLTSNNNKKSKTKMHTDTTGQSGGPAGVFRTSPIAFSKAVKNSAELEGMLNSHLRDAAALAQFWVWLEEEIHNGAKLTEVDVADKLLEFRSKQSGFLDTSFDTISGSGANGAIIHYKPEPGKCSVVDSKKLFLLDSGAQYVDGTTDITRTVHFGEPTAREKECFTRVLQGHIALDQAIFPQSTPGFVLDAFARSSLWKIGLDYRHGTGHGVGAALNVHEGPQSISFRYGNMTPLVEGMIVSNEPGYYEDHAFGIRIENLLYVKEVGTPNRFGGVSYLGFEKLTFVPIQTKLVDLSLLSAAEIDWLNNYHSQVWEKVSKSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable Xaa-Pro aminopeptidase P Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides.probableA2QGR5
Probable Xaa-Pro aminopeptidase P Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides.probableQ4WUD3
Xaa-Pro aminopeptidase 1 Contributes to the degradation of bradykinin. Catalyzes the removal of a penultimate prolyl residue from the N-termini of peptides, such as Arg-Pro-Pro.probableO54975

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.11.-Aminopeptidases.probable
3.4.11.9Xaa-Pro aminopeptidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CTZ, chain A
Confidence level:very confident
Coverage over the Query: 83-380,400-689
View the alignment between query and template
View the model in PyMOL
Template: 4EGE, chain A
Confidence level:confident
Coverage over the Query: 272-638
View the alignment between query and template
View the model in PyMOL