Citrus Sinensis ID: 005527


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690--
MMVDGVEDEEKWLAAGIAGLQQNAFYMHRALDSNNLRDALKYSAQMLSELRTSKLSPQKYYQLYMRAFDELRKLEMFFKEETRRGCSIIDLYELVQHAGNILPRLYLLCTVGSVYIKSKEAPAKDVLKDLVEMCRGIQHPVRGLFLRSYLSQISRDKLPDIGSEYEGDADTVNDAMEFVLQNFTEMNKLWVRMQHQGPAREKDKREKERSELRDLVGKNLHVLSQIEGVDLDTYKETVLPRVLEQVVNCKDEIAQCYLMDCIIQVFPDEYHLQTLEILLGAFPQLQPSVDIKTVLSRLMERLSNYAASSTEVLPEFLQVEAFSKLNNAIGKVIEAQADMPILGAVTLYSSLLTFTLHVHPDRLDYADQVLGACVKKLSGEGKLEDNRATKQIVALLSAPLDKYNDIVTVLKLSNYPSVMEYVDSETNKVMAMVIIQSIMKNNTQISTADKVGALFELIKGLIRDLDGAAHDQVDEDDFKEEQNSVARLIQMLQNDDTEEMFKIICTVRKHILTGGPKRLPFTVPPLVFSSLKLVRQLQGPEENPFGEEGSTTPKKVFQLLNQTIETLYGVPAPELALRLYLQCAEAANDSDLEPVAYEFFTQAYILYEEEISDSRAQVTAIHLIIGTLQRMHVFGVENRDTLTHKATGYSAKLLKKPDQCRAVYACSHLFWVDDQDNMKDGERFVIVHLFII
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcHHHHHHcHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccccEEEEEEcccc
****G*E**EKWLAAGIAGLQQNAFYMHRALDSNNLRDALKYSAQMLSELRTSKLSPQKYYQLYMRAFDELRKLEMFFKEETRRGCSIIDLYELVQHAGNILPRLYLLCTVGSVYIKSKEAPAKDVLKDLVEMCRGIQHPVRGLFLRSYLSQISRDKLPDIGSEYEGDADTVNDAMEFVLQNFTEMNKLWVR******************ELRDLVGKNLHVLSQIEGVDLDTYKETVLPRVLEQVVNCKDEIAQCYLMDCIIQVFPDEYHLQTLEILLGAFPQLQPSVDIKTVLSRLMERLSNYAASSTEVLPEFLQVEAFSKLNNAIGKVIEAQADMPILGAVTLYSSLLTFTLHVHPDRLDYADQVLGACVKKLSGEGKLEDNRATKQIVALLSAPLDKYNDIVTVLKLSNYPSVMEYVDSETNKVMAMVIIQSIMKNNTQISTADKVGALFELIKGLIRDLDGAA********FKEEQNSVARLIQMLQNDDTEEMFKIICTVRKHILTGGPKRLPFTVPPLVFSSLKLVRQLQG*********GSTTPKKVFQLLNQTIETLYGVPAPELALRLYLQCAEAANDSDLEPVAYEFFTQAYILYEEEISDSRAQVTAIHLIIGTLQRMHVFGVENRDTLTHKATGYSAKLLKKPDQCRAVYACSHLFWVDDQDNMKDGERFVIVHLFII
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMVDGVEDEEKWLAAGIAGLQQNAFYMHRALDSNNLRDALKYSAQMLSELRTSKLSPQKYYQLYMRAFDELRKLEMFFKEETRRGCSIIDLYELVQHAGNILPRLYLLCTVGSVYIKSKEAPAKDVLKDLVEMCRGIQHPVRGLFLRSYLSQISRDKLPDIGSEYEGDADTVNDAMEFVLQNFTEMNKLWVRMQHQGPAREKDKREKERSELRDLVGKNLHVLSQIEGVDLDTYKETVLPRVLEQVVNCKDEIAQCYLMDCIIQVFPDEYHLQTLEILLGAFPQLQPSVDIKTVLSRLMERLSNYAASSTEVLPEFLQVEAFSKLNNAIGKVIEAQADMPILGAVTLYSSLLTFTLHVHPDRLDYADQVLGACVKKLSGEGKLEDNRATKQIVALLSAPLDKYNDIVTVLKLSNYPSVMEYVDSETNKVMAMVIIQSIMKNNTQISTADKVGALFELIKGLIRDLDGAAHDQVDEDDFKEEQNSVARLIQMLQNDDTEEMFKIICTVRKHILTGGPKRLPFTVPPLVFSSLKLVRQLQGPEENPFGEEGSTTPKKVFQLLNQTIETLYGVPAPELALRLYLQCAEAANDSDLEPVAYEFFTQAYILYEEEISDSRAQVTAIHLIIGTLQRMHVFGVENRDTLTHKATGYSAKLLKKPDQCRAVYACSHLFWVDDQDNMKDGERFVIVHLFII

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 35A Plays a role in vesicular protein sorting. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. Also involved in the efficient sorting of seed storage proteins (By similarity). The VPS29-VPS26-VPS35 subcomplex may be involved in recycling of specific cargos from endosome to the plasma membrane.confidentQ7X659
Vacuolar protein sorting-associated protein 35 Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA).probableQ2HJG5
Vacuolar protein sorting-associated protein 35B Plays a role in vesicular protein sorting. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. Also involved in the efficient sorting of seed storage proteins globulin 12S and albumin 2S. The VPS29-VPS26-VPS35 subcomplex may be involved in recycling of specific cargos from endosome to the plasma membrane.probableF4I0P8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R17, chain C
Confidence level:very confident
Coverage over the Query: 477-683
View the alignment between query and template
View the model in PyMOL