Citrus Sinensis ID: 005553

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-

MAVYLGTLMLWVLMPTNTYRQNWLPHLRAKFGFTTYFGAQGTTLLIYTFPILFIAVTGCLYLHLGNKLNDNNVLERNGKKHRLGIWKKPMLVKGPLGIVSGIELAFFMMLIALLIWSLSNYLHNSFADITPQSAAEEGVKVWQGKLESTALRFGLVGNICLTLLFFPVARGSSVLPLFGLTSEASIKYHIWLGHMVMTLFTAHGVCYIIFWAVTNNISEMLQWAKIGISNVAGELALLSGLAMWATTFPPIRRKFFELFFYTHYLYILFVVFFVFHVGISYSLIMLPSFYLFVVDRYLRFLQSRRAVRLVSARMLPGETVELNFSKAPGLSYNPTSIMFINVPSISKLQWHPFTVTSSSNLEPEKLSVVIKGEGSWSKKLYQVLSSPSSIDRLDVSVEGPYGPVSTHFLRHDTLVMVSGGSGITPFISVIRELMYASTVTKCKTPQVILICSFKNSSDLTMLDLLLPISGTPTELPNLKLQIEAYVTREKQPTTDNSKLIRALWFKPLATDAPISSVLGPNRWLWLGAIISSSFIIFLILIGIVGSYYIYPIDHNSNQIFSFTLRAFLNMLVLCVSIAATASAAVLWNKKQNAKEATQIQHMEGSTPAGSPNSWFYNADRELESLPRQSLIQATIVHYGKRPELKRMLFECKESSVGVLVSGPKRMRHEVATICSSGLAANLHFESISFSW

cEEEEHHHHHHHHccccHHHHHHHHHHHHHccccCCcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEECcccEEEEEEEcccccccccccEEEEECccccccccccccccccccccccEEEEEEEccccHHHHHHHHHccccccccCEEEEEccccccccccccccEEEEEEcccccHcHHHHHHHHHHHHccccccccEEEEEEECccccccccHHHHccccccccccccccEEEEEEEEccccccccccHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcEEEEEECccccccccccHHHHHHHHHHHHHHHHHccEEEEEEccccccHHHHHHccccccccccccccccccccccccccccccccccccEEEcccccHHHHHHHccccCEEEEEEccHHHHHHHHHHHHccccccCEEEEEcccc

MAVYLGTLMLWVLMPTNTYRQNWLPHLRAKFGFTTYFGAQGTTLLIYTFPILFIAVTGCLYLHLGNKLNDNNVLERNGKKHRLGIWKKPMLVKGPLGIVSGIELAFFMMLIALLIWSLSNYLHNSFADITPQSAAEEGVKVWQGKLESTALRFGLVGNICLTLLFFPVARGSSVLPLFGLTSEASIKYHIWLGHMVMTLFTAHGVCYIIFWAVTNNISEMLQWAKIGISNVAGELALLSGLAMWATTFPPIRRKFFELFFYTHYLYILFVVFFVFHVGISYSLIMLPSFYLFVVDRYLRFLQSRRAVRLVSARMLPGETVELNFSKAPGLSYNPTSIMFINVPSISKLQWHPFTVTSSSNLEPEKLSVVIKGEGSWSKKLYQVLSSPSSIDRLDVSVEGPYGPVSTHFLRHDTLVMVSGGSGITPFISVIRELMYASTVTKCKTPQVILICSFKNSSDLTMLDLLLPISGTPTELPNLKLQIEAYVTRE*****DNSKLIRALWFKPLATDAPISSVLGPNRWLWLGAIISSSFIIFLILIGIVGSYYIYPIDHNSNQIFSFTLRAFLNMLVLCVSIAATASAAVLWNK****************************ADRELESLPRQSLIQATIVHYGKRPELKRMLFECKESSVGVLVSGPKRMRHEVATICSSGLAANLHFESISFSW

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ferric reduction oxidase 2	Flavocytochrome that transfers electrons across the plasma membrane to reduce ferric iron chelates to form soluble ferrous iron in the rhizosphere. May be involved in the delivery of iron to developing pollen grains. Acts also as a copper-chelate reductase. Involved in glycine betaine-mediated chilling tolerance and reactive oxygen species accumulation.	probable	P92949

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CND, chain A
Confidence level:probable
Coverage over the Query: 303-465
View the alignment between query and template
View the model in PyMOL

Template: 3A1F, chain A
Confidence level:probable
Coverage over the Query: 395-489,514-523
View the alignment between query and template
View the model in PyMOL