Citrus Sinensis ID: 005586

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------69

MGISHVLIPLLVLITSSLTGLVCGNTELRALLDLKASLDPENKLLQSWTENGDPCSGSFEGIACNEHRKVANISLQGKGLTGKLSPSLSGLKCLSGLYLHYNSLSGEIPKEIRNLTELTDLYLDVNNLSGNIPPEIGSMASLQVLQLCCNQLTGNIPAQIGSLKSLSVLTLQHNRLNGGIPDSLGNLGKLKRLDLSFNSLFGTIPESLANNAELLFLDVQNNTLSGIVPSALKRLNGGFQFQNNPGLCGDGIASLRACTVYDNTQINPVKPFGSHSNDTTPIDISEPSGFKEHCNQSQCSNSSKFPQIAVLAAVTSVTVILAGTGILIFFRYRRHKQKIGNTSESSDWQLSTDLTLAKDFNRNGASPLVSLEYCHGWDPLGDYLNGTGFSREHLNSFRLNLEEVESATQCFSEVNLLGKGNFSSVYKGTLRDGTLVAIRSINVTSCKSEEAEFVKGLYLLTSLRHENIIRLRGFCCSRGRGECFLIYDFAPKGKLSKYLDQEEGSSNVLDWSTRVSIIIGIAKGIGYLHSSEVNKPAIVHRNLSVEKVLIDQQFNPLIADCGLHKLLADDIVFSVLKTSAAMGYLAPEYVTTGRFTERSDIFAFGVIILQILTGSLVLTSSMRLAAESATFENFIDRNLKGKFSESEAAKLGKMALVCTHEDPENRPTMEAVIEELTVAAPVMATFLFS

cccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccccccccccCECccccccEEEEEEcccccCCcccccccccccccEEEccccccCCcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccCCccccccccccccccEEcccccccccccHHHHccccccEEEccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHHHHHHHHHHHEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEccccccEEEEEECccccEEEEEEEcccccccHHHHHHHHHHHHccccccccccccEEEECccccCEEEEEcccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccccccccEEcccccccccccccccEEEcccccccccccccccEEEcccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHccccEEEcccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccc

*GISHVLIPLLVLITSSLTGLVCGNTELRALLDLKASLDPENKLLQSWTENGDPCSGSFEGIACNEHRKVANISLQGKGLTGKLSPSLSGLKCLSGLYLHYNSLSGEIPKEIRNLTELTDLYLDVNNLSGNIPPEIGSMASLQVLQLCCNQLTGNIPAQIGSLKSLSVLTLQHNRLNGGIPDSLGNLGKLKRLDLSFNSLFGTIPESLANNAELLFLDVQNNTLSGIVPSALKRLNGGFQFQNNPGLCGDGIASLRACTVYDNTQINPVKPFG*******************************FPQIAVLAAVTSVTVILAGTGILIFFRYRRHKQ***********QLSTDLTLAKDFNR**ASPLVS*****************GFSREHLNSFRLNLEEVESATQCFSEVNLLGKGNFSSVYKGTLRDGTLVAIRSINVTSCKSEEAEFVKGLYLLTSLRHENIIRLRGFCCSRGRGECFLIYDFAPKGKLSKYLDQEEGSSNVLDWSTRVSIIIGIAKGIGYLHSSEVNKPAIVHRNLSVEKVLIDQQFNPLIADCGLHKLLADDIVFSVLKTSAAMGYLAPEYVTTGRFTERSDIFAFGVIILQILTGSLVLTSSMRLAAESATFENFIDRNLKGKFSESEAAKLGKMALVCTHEDPENRPTMEAVIEELTVAAPV***F***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QKW, chain B
Confidence level:very confident
Coverage over the Query: 400-676
View the alignment between query and template
View the model in PyMOL

Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 22-235
View the alignment between query and template
View the model in PyMOL

Template: 1B6C, chain B
Confidence level:confident
Coverage over the Query: 378-676
View the alignment between query and template
View the model in PyMOL

Template: 2J0J, chain A
Confidence level:confident
Coverage over the Query: 324-334,370-404,417-569,580-613
View the alignment between query and template
View the model in PyMOL

Template: 1OGQ, chain A
Confidence level:confident
Coverage over the Query: 22-235
View the alignment between query and template
View the model in PyMOL

Template: 1O6V, chain A
Confidence level:confident
Coverage over the Query: 86-247
View the alignment between query and template
View the model in PyMOL

Template: 3J0A, chain A
Confidence level:probable
Coverage over the Query: 93-294,305-333
View the alignment between query and template
View the model in PyMOL