BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 005642
(686 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its
Peptide-Ligand (Hsp90 Peptide)
pdb|3KD7|B Chain B, Designed Tpr Module (Ctpr390) In Complex With Its
Peptide-Ligand (Hsp90 Peptide)
pdb|3KD7|C Chain C, Designed Tpr Module (Ctpr390) In Complex With Its
Peptide-Ligand (Hsp90 Peptide)
pdb|3KD7|D Chain D, Designed Tpr Module (Ctpr390) In Complex With Its
Peptide-Ligand (Hsp90 Peptide)
pdb|3KD7|E Chain E, Designed Tpr Module (Ctpr390) In Complex With Its
Peptide-Ligand (Hsp90 Peptide)
Length = 125
Score = 31.6 bits (70), Expect = 1.4, Method: Composition-based stats.
Identities = 13/51 (25%), Positives = 26/51 (50%)
Query: 508 WSSILRGCVAHGDKGLGRKVAERMIELDPENACAYIQLSSIFATSGEWEKS 558
W ++ GD + ++ +ELDP NA A+ L + + G+++K+
Sbjct: 12 WKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKA 62
>pdb|1XAG|A Chain A, Crystal Structure Of Staphlyococcus Aureus
3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
Nad+ And Carbaphosphonate
pdb|1XAH|A Chain A, Crystal Structure Of Staphlyococcus Aureus
3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+
And Nad+
pdb|1XAH|B Chain B, Crystal Structure Of Staphlyococcus Aureus
3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+
And Nad+
pdb|1XAI|A Chain A, Crystal Structure Of Staphlyococcus Aureus
3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
Nad+ And Carbaphosphonate
pdb|1XAI|B Chain B, Crystal Structure Of Staphlyococcus Aureus
3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
Nad+ And Carbaphosphonate
pdb|1XAJ|A Chain A, Crystal Structure Of Staphlyococcus Aureus
3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
Nad+ And Carbaphosphonate
pdb|1XAJ|B Chain B, Crystal Structure Of Staphlyococcus Aureus
3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
Nad+ And Carbaphosphonate
pdb|1XAL|A Chain A, Crystal Structure Of Staphlyococcus Aureus
3-dehydroquinate Synthase (dhqs) In Complex With Zn2+,
Nad+ And Carbaphosphonate (soak)
pdb|1XAL|B Chain B, Crystal Structure Of Staphlyococcus Aureus
3-dehydroquinate Synthase (dhqs) In Complex With Zn2+,
Nad+ And Carbaphosphonate (soak)
Length = 354
Score = 30.8 bits (68), Expect = 2.8, Method: Compositional matrix adjust.
Identities = 13/22 (59%), Positives = 16/22 (72%)
Query: 260 HGHACKVGVIDDVIVASALLDT 281
HGHA VG+I IVA+AL D+
Sbjct: 256 HGHAVMVGIIYQFIVANALFDS 277
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.136 0.418
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,322,207
Number of Sequences: 62578
Number of extensions: 772334
Number of successful extensions: 2150
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2147
Number of HSP's gapped (non-prelim): 3
length of query: 686
length of database: 14,973,337
effective HSP length: 105
effective length of query: 581
effective length of database: 8,402,647
effective search space: 4881937907
effective search space used: 4881937907
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 55 (25.8 bits)