BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 005642
         (686 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its
           Peptide-Ligand (Hsp90 Peptide)
 pdb|3KD7|B Chain B, Designed Tpr Module (Ctpr390) In Complex With Its
           Peptide-Ligand (Hsp90 Peptide)
 pdb|3KD7|C Chain C, Designed Tpr Module (Ctpr390) In Complex With Its
           Peptide-Ligand (Hsp90 Peptide)
 pdb|3KD7|D Chain D, Designed Tpr Module (Ctpr390) In Complex With Its
           Peptide-Ligand (Hsp90 Peptide)
 pdb|3KD7|E Chain E, Designed Tpr Module (Ctpr390) In Complex With Its
           Peptide-Ligand (Hsp90 Peptide)
          Length = 125

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 26/51 (50%)

Query: 508 WSSILRGCVAHGDKGLGRKVAERMIELDPENACAYIQLSSIFATSGEWEKS 558
           W ++       GD     +  ++ +ELDP NA A+  L + +   G+++K+
Sbjct: 12  WKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQGDYQKA 62


>pdb|1XAG|A Chain A, Crystal Structure Of Staphlyococcus Aureus
           3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
           Nad+ And Carbaphosphonate
 pdb|1XAH|A Chain A, Crystal Structure Of Staphlyococcus Aureus
           3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+
           And Nad+
 pdb|1XAH|B Chain B, Crystal Structure Of Staphlyococcus Aureus
           3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+
           And Nad+
 pdb|1XAI|A Chain A, Crystal Structure Of Staphlyococcus Aureus
           3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
           Nad+ And Carbaphosphonate
 pdb|1XAI|B Chain B, Crystal Structure Of Staphlyococcus Aureus
           3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
           Nad+ And Carbaphosphonate
 pdb|1XAJ|A Chain A, Crystal Structure Of Staphlyococcus Aureus
           3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
           Nad+ And Carbaphosphonate
 pdb|1XAJ|B Chain B, Crystal Structure Of Staphlyococcus Aureus
           3-Dehydroquinate Synthase (Dhqs) In Complex With Zn2+,
           Nad+ And Carbaphosphonate
 pdb|1XAL|A Chain A, Crystal Structure Of Staphlyococcus Aureus
           3-dehydroquinate Synthase (dhqs) In Complex With Zn2+,
           Nad+ And Carbaphosphonate (soak)
 pdb|1XAL|B Chain B, Crystal Structure Of Staphlyococcus Aureus
           3-dehydroquinate Synthase (dhqs) In Complex With Zn2+,
           Nad+ And Carbaphosphonate (soak)
          Length = 354

 Score = 30.8 bits (68), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 16/22 (72%)

Query: 260 HGHACKVGVIDDVIVASALLDT 281
           HGHA  VG+I   IVA+AL D+
Sbjct: 256 HGHAVMVGIIYQFIVANALFDS 277


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.418 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,322,207
Number of Sequences: 62578
Number of extensions: 772334
Number of successful extensions: 2150
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 2147
Number of HSP's gapped (non-prelim): 3
length of query: 686
length of database: 14,973,337
effective HSP length: 105
effective length of query: 581
effective length of database: 8,402,647
effective search space: 4881937907
effective search space used: 4881937907
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 55 (25.8 bits)