Citrus Sinensis ID: 005658

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-----
MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYDFNPIIDEWCKEAPKELDFNSEAENTRIVSANLGCKNKHEDSNKKPAYEVDVLIPEVIQSSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTLFFRTSAPANEAFETVKNLSEQRAKNLKVIQEKMKLNQKEVKRFNPVDAFPGDIVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVGINKEPSVSAEWIYSKPIHSDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPGTNFLLHQIQRSC
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHccccccccccccHHHHHEEEEcccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEEcccEEEEEcccccccccHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEccccccEEEEEccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHcHHHHHcccccccHHHHHHccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHccHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEcEEEEccccEEEEEEEcccEcccHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccccEEEEEccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHcHHHHHHHHHHHHHccccccEEEEEEEcccEEEEcccccccccccccccccccccEEEHcHHHHHHHHHHHHHccccccHHHHHHccHHHccccccEEEEEEEEccccHHHHHccccccccccEEccHHHHHHHHHHcccccccccHHEEHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHccc
mgwgniyrRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIKLEGLWVKLGQYLstradvlpepYISLLKQLqdslpprpvqevSQTIEREFgesmggmfmdfvetplatASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIawaepqydfnpiiDEWCKeapkeldfnseaenTRIVSAnlgcknkhedsnkkpayevdvlipeviQSSETVLILEFMdgirlndcESLEAFGVNKQKVVEEITRAYAHQIyvdgffngdphpgnflvskdpphrpilldfglTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTlffrtsapaneAFETVKNLSEQRAKNLKVIQEKMKLNQKevkrfnpvdafpgdiVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVginkepsvsaewiyskpihsdvEAKLRDFLVELGNDGKILGIQVCAykdgeviidtsagmlgrydprpvqpdslfpvfSVTKGITAGMLHWLvdngklkleENIANIWpefksngkdlIKVHHVLNHtsglhnvsvdlssenpllicdwdECLNRialsapetepgqeQLYHYLSFGWLCGGIIERASGKKFQEILEEGiiqplsidgelyigippgtnfLLHQIQRSC
MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKqlqdslpprpVQEVSQTIEREFGESMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYDFNPIIDEWCKEAPKELDFNSEAENTRIVSanlgcknkhedsnkkpayevDVLIPEVIQSSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTLFFRTSAPANEAFETVKNLSEQRAKNLKVIQEKMKlnqkevkrfnpvdafpgdiVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVGINKEPSVSAEWIYSKPIHSDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPGTNFLLHQIQRSC
MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYDFNPIIDEWCKEAPKELDFNSEAENTRIVSANLGCKNKHEDSNKKPAYEVDVLIPEVIQSSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTLFFRTSAPANEAFETVKNLSEQRAKNLKVIQEKMKLNQKEVKRFNPVDAFPGDIVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVGINKEPSVSAEWIYSKPIHSDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPGTNFLLHQIQRSC
**WGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQL**********************SMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYDFNPIIDEWCKEAPKEL**********IV*****************AYEVDVLIPEVIQSSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTLFFRTSA********************************EVKRFNPVDAFPGDIVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVGINKEPSVSAEWIYSKPIHSDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPET*PGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPGTNFLLHQI****
*GWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKK***********ERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYDFNPIIDEWCKEAPKELDFNSEAENTRIVSANLGCKNKHEDSNKKPAYEVDVLIPEVIQSSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTLFFRTSAPANEAFETVKN***********IQEKMKLNQKEVKRFNPVDAFPGDIVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVGI*******AEWIYSKPIHSDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPGTNFLLHQIQR**
MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYDFNPIIDEWCKEAPKELDFNSEAENTRIVSANLGCKNKHEDSNKKPAYEVDVLIPEVIQSSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTLFFRTSAPANEAFETVKNLSEQRAKNLKVIQEKMKLNQKEVKRFNPVDAFPGDIVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVGINKEPSVSAEWIYSKPIHSDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPGTNFLLHQIQRSC
MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYDFNPIIDEWCKEAPKELDFNSEAENTRIVSANLGCK********KPAYEVDVLIPEVIQSSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTLFFRTSAPANEAFETVKNLSEQRAKNLKVIQEKMKLNQKEVKRFNPVDAFPGDIVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVGINKEPSVSAEWIYSKPIHSDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPGTNFLLHQI***C
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYDFNPIIDEWCKEAPKELDFNSEAENTRIVSANLGCKNKHEDSNKKPAYEVDVLIPEVIQSSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTLFFRTSAPANEAFETVKNLSEQRAKNLKVIQEKMKLNQKEVKRFNPVDAFPGDIVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVGINKEPSVSAEWIYSKPIHSDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPGTNFLLHQIQRSC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query685 2.2.26 [Sep-21-2011]
Q86TW2530 Uncharacterized aarF doma yes no 0.404 0.522 0.353 1e-42
Q9D0L4525 Uncharacterized aarF doma yes no 0.391 0.510 0.343 4e-39
Q5ZMT7519 Uncharacterized aarF doma yes no 0.416 0.549 0.331 6e-39
P73577408 Uncharacterized protein s N/A no 0.395 0.664 0.334 2e-38
P73627585 Uncharacterized protein s N/A no 0.480 0.562 0.296 5e-38
Q6INL7520 Uncharacterized aarF doma N/A no 0.408 0.538 0.322 1e-37
Q46189530 Uncharacterized protein i N/A no 0.397 0.513 0.320 2e-37
Q5M7P6523 Uncharacterized aarF doma yes no 0.408 0.535 0.322 2e-37
Q55884567 Uncharacterized protein s N/A no 0.418 0.506 0.331 2e-37
Q54P00695 Probable serine/threonine yes no 0.448 0.441 0.288 5e-37
>sp|Q86TW2|ADCK1_HUMAN Uncharacterized aarF domain-containing protein kinase 1 OS=Homo sapiens GN=ADCK1 PE=2 SV=2 Back     alignment and function desciption
 Score =  175 bits (443), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 161/291 (55%), Gaps = 14/291 (4%)

Query: 36  KSKISALWQRAHERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLP 95
           +SK   ++ + H R+A+R+  L     G ++K+GQ+L     +LPE Y S LK L    P
Sbjct: 71  RSKSWPVFLQVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLHSQAP 130

Query: 96  PRPVQEVSQTIEREFGESMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKVQHQGIK 155
              +QE+ Q I  + G+ +  +F  F +TPL TAS+AQVH+A L DGR V VKVQH  ++
Sbjct: 131 QSSMQEIRQVIREDLGKEIHDLFQSFDDTPLGTASLAQVHKAVLHDGRTVAVKVQHPKVR 190

Query: 156 TIILEDLKNAKSIVDWIAWAEPQYDFNPIIDEWCKEAPKELDFNSEAENTRIVSANLGCK 215
               +D+   + +V  +    P+++F  ++DE  K  P ELDF +E  N   VS  L   
Sbjct: 191 AQSSKDILLMEVLVLAVKQLFPEFEFMWLVDEAKKNLPLELDFLNEGRNAEKVSQML--- 247

Query: 216 NKHEDSNKKPAYEVDVLIPEVIQSSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEIT 275
            +H D  K P    D+       S+E VL++EF+DG ++ND + +E   ++  ++   + 
Sbjct: 248 -RHFDFLKVPRIHWDL-------STERVLLMEFVDGGQVNDRDYMERNKIDVNEISRHLG 299

Query: 276 RAYAHQIYVDGFFNGDPHPGNFLVSKDP---PHRPILLDFGLTKKLSSSMK 323
           + Y+  I+V+GF + DPHPGN LV K P       +LLD GL + L+   +
Sbjct: 300 KMYSEMIFVNGFVHCDPHPGNVLVRKHPGTGKAEIVLLDHGLYQMLTEEFR 350
The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q9D0L4|ADCK1_MOUSE Uncharacterized aarF domain-containing protein kinase 1 OS=Mus musculus GN=Adck1 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZMT7|ADCK1_CHICK Uncharacterized aarF domain-containing protein kinase 1 OS=Gallus gallus GN=ADCK1 PE=2 SV=1 Back     alignment and function description
>sp|P73577|Y889_SYNY3 Uncharacterized protein slr0889 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0889 PE=3 SV=1 Back     alignment and function description
>sp|P73627|Y1770_SYNY3 Uncharacterized protein sll1770 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1770 PE=3 SV=1 Back     alignment and function description
>sp|Q6INL7|ADCK1_XENLA Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus laevis GN=adck1 PE=2 SV=1 Back     alignment and function description
>sp|Q46189|YHG1_CLOPA Uncharacterized protein in hydrogenase 1 5'region (Fragment) OS=Clostridium pasteurianum PE=3 SV=1 Back     alignment and function description
>sp|Q5M7P6|ADCK1_XENTR Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus tropicalis GN=adck1 PE=2 SV=1 Back     alignment and function description
>sp|Q55884|Y095_SYNY3 Uncharacterized protein sll0095 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0095 PE=3 SV=1 Back     alignment and function description
>sp|Q54P00|ABKD_DICDI Probable serine/threonine-protein kinase abkD OS=Dictyostelium discoideum GN=abkD PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query685
255574137 965 Ubiquinone biosynthesis protein coq-8, p 0.979 0.695 0.806 0.0
225429826 978 PREDICTED: uncharacterized protein LOC10 0.978 0.685 0.802 0.0
296081786683 unnamed protein product [Vitis vinifera] 0.970 0.973 0.800 0.0
356563711 966 PREDICTED: uncharacterized protein LOC10 0.979 0.694 0.774 0.0
356552616 965 PREDICTED: uncharacterized protein LOC10 0.979 0.695 0.772 0.0
449437042 965 PREDICTED: uncharacterized protein LOC10 0.973 0.691 0.771 0.0
297812683 1011 ABC1 family protein [Arabidopsis lyrata 0.978 0.662 0.777 0.0
18420844 1009 ABC1 family protein [Arabidopsis thalian 0.978 0.664 0.775 0.0
224121392 972 predicted protein [Populus trichocarpa] 0.975 0.687 0.777 0.0
356563713 994 PREDICTED: uncharacterized protein LOC10 0.979 0.675 0.743 0.0
>gi|255574137|ref|XP_002527984.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] gi|223532610|gb|EEF34396.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/673 (80%), Positives = 624/673 (92%), Gaps = 2/673 (0%)

Query: 1   MGWGNIYRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISALWQRAHERNAKRVLNLIIK 60
           MGWGNIY+RR+ VF++AI+IYLDYKA+QQR+KW  KSK +ALW++AHERNAKRVLNLII+
Sbjct: 1   MGWGNIYKRRVRVFAVAIMIYLDYKAIQQRDKWTIKSKKTALWEKAHERNAKRVLNLIIE 60

Query: 61  LEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMD 120
           LEGLWVKLGQYLSTRADVLP  YISLLK+LQDSLPPRP+QEV QTI++E G+S+  +F  
Sbjct: 61  LEGLWVKLGQYLSTRADVLPHAYISLLKKLQDSLPPRPLQEVCQTIQKELGKSLDDLFSY 120

Query: 121 FVETPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYD 180
           F  TPLATASIAQVHRATL++G++VVVKVQH+GIKTIILEDLKNAKSIVDWIAWAEPQYD
Sbjct: 121 FDRTPLATASIAQVHRATLINGQEVVVKVQHEGIKTIILEDLKNAKSIVDWIAWAEPQYD 180

Query: 181 FNPIIDEWCKEAPKELDFNSEAENTRIVSANLGCKNKHEDSNKKPAYEVDVLIPEVIQSS 240
           FNP+IDEWCKEAPKELDFN EAENTRIVS+NLGC+NK++DS  + A +VDVLIPEVIQSS
Sbjct: 181 FNPMIDEWCKEAPKELDFNIEAENTRIVSSNLGCRNKNKDS--RHANQVDVLIPEVIQSS 238

Query: 241 ETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVS 300
           E VLILE+MDGIRLND ESLEA+GV+KQKVVEEITRAYA+QIY+DGFFNGDPHPGNFLVS
Sbjct: 239 EKVLILEYMDGIRLNDLESLEAYGVDKQKVVEEITRAYAYQIYIDGFFNGDPHPGNFLVS 298

Query: 301 KDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQA 360
           KDP HRP+LLDFGLTKK+SSS+KQALAKMF A+ EGDHVALLSAFAEMGL+LRLD+PEQA
Sbjct: 299 KDPQHRPVLLDFGLTKKISSSIKQALAKMFLASVEGDHVALLSAFAEMGLKLRLDLPEQA 358

Query: 361 MEVSTLFFRTSAPANEAFETVKNLSEQRAKNLKVIQEKMKLNQKEVKRFNPVDAFPGDIV 420
           MEV+ +FFRTS PANEAFE +K+L+EQR+KN+KVIQEKMKL+QKEVKRFNPVDAFPGDIV
Sbjct: 359 MEVTNVFFRTSTPANEAFENMKSLAEQRSKNMKVIQEKMKLSQKEVKRFNPVDAFPGDIV 418

Query: 421 IFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVLQVGINKEPSVSAEWIYSKPIHSDVEA 480
           IFSRVLNLLRGLSSTMNVRI+Y +IMRPFAE+ LQ  INK P+V+A+WI++ P+HSDVE 
Sbjct: 419 IFSRVLNLLRGLSSTMNVRIIYQEIMRPFAEFALQGNINKGPTVNAQWIHNTPVHSDVET 478

Query: 481 KLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGI 540
           KLR  L+ELGN+ KILGIQVCAYKDGEVIIDT+AG+LGRYDPRPVQPDSLFPVFSVTKGI
Sbjct: 479 KLRQLLIELGNEDKILGIQVCAYKDGEVIIDTAAGVLGRYDPRPVQPDSLFPVFSVTKGI 538

Query: 541 TAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPL 600
           TAGMLHWLVDNGK+KL++++ANIWP+F ++GKDLIKV+HVLNHTSGLHN   +L  ENP+
Sbjct: 539 TAGMLHWLVDNGKVKLDDSVANIWPQFGTSGKDLIKVYHVLNHTSGLHNALSNLREENPM 598

Query: 601 LICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPL 660
            +C+WDECLN+I LS PETEPG+EQLYHYLSFGWLCGGIIE ASGK+FQEILEE II+PL
Sbjct: 599 QLCNWDECLNQICLSVPETEPGKEQLYHYLSFGWLCGGIIEHASGKRFQEILEEAIIRPL 658

Query: 661 SIDGELYIGIPPG 673
            I+GELY+GIPPG
Sbjct: 659 KIEGELYVGIPPG 671

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225429826|ref|XP_002283043.1| PREDICTED: uncharacterized protein LOC100242392 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081786|emb|CBI20791.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356563711|ref|XP_003550103.1| PREDICTED: uncharacterized protein LOC100775929 isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|356552616|ref|XP_003544660.1| PREDICTED: uncharacterized protein LOC100802638 [Glycine max] Back     alignment and taxonomy information
>gi|449437042|ref|XP_004136301.1| PREDICTED: uncharacterized protein LOC101216220 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297812683|ref|XP_002874225.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata] gi|297320062|gb|EFH50484.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18420844|ref|NP_568458.1| ABC1 family protein [Arabidopsis thaliana] gi|16649083|gb|AAL24393.1| Unknown protein [Arabidopsis thaliana] gi|33589758|gb|AAQ22645.1| At5g24810/F6A4.20 [Arabidopsis thaliana] gi|332005981|gb|AED93364.1| ABC1 family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224121392|ref|XP_002330816.1| predicted protein [Populus trichocarpa] gi|222872618|gb|EEF09749.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356563713|ref|XP_003550104.1| PREDICTED: uncharacterized protein LOC100775929 isoform 2 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query685
TAIR|locus:2177487479 AT5G50330 [Arabidopsis thalian 0.610 0.872 0.304 4.2e-45
TAIR|locus:2126793481 AT4G24810 [Arabidopsis thalian 0.611 0.871 0.292 2e-42
UNIPROTKB|Q86TW2530 ADCK1 "Uncharacterized aarF do 0.437 0.566 0.345 1.6e-41
TAIR|locus:2009764551 AT1G65950 [Arabidopsis thalian 0.454 0.564 0.323 2.8e-40
TAIR|locus:2177719761 ATH13 "AT5G64940" [Arabidopsis 0.570 0.513 0.296 3.9e-40
ZFIN|ZDB-GENE-080401-5521 adck1 "aarF domain containing 0.458 0.602 0.315 1.3e-39
UNIPROTKB|E2RSN4513 ADCK1 "Uncharacterized protein 0.436 0.582 0.336 1.7e-39
UNIPROTKB|F1SE04455 ADCK1 "Uncharacterized protein 0.391 0.589 0.351 6.2e-39
UNIPROTKB|F1MYG8523 ADCK1 "Uncharacterized protein 0.436 0.571 0.333 1.3e-38
UNIPROTKB|Q5ZMT7519 ADCK1 "Uncharacterized aarF do 0.465 0.614 0.313 3.7e-38
TAIR|locus:2177487 AT5G50330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 475 (172.3 bits), Expect = 4.2e-45, P = 4.2e-45
 Identities = 141/463 (30%), Positives = 228/463 (49%)

Query:     7 YRRRMSVFSMAILIYLDYKAVQQREKWIKKSKISA-LWQRAHERNAKRVLNLIIKLEGLW 65
             ++R    +  A  IY  YK  Q R   +K +K    +W+R HE+ A ++  +   L G +
Sbjct:    20 WQRSFQFWVRATNIYTGYKVFQLRVSLVKDAKKQEEMWERQHEQAADKIYFMCSDLGGFF 79

Query:    66 VKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMDFVETP 125
             +K+ Q L+ + D+ P  ++  L  L D  P  P   +   +E+E G+S+G +F  F E P
Sbjct:    80 LKIAQLLA-KPDMAPAAWVKKLVTLCDQAPATPFDAIQLVLEKELGKSIGEIFETFDEKP 138

Query:   126 LATASIAQVHRATLVDGRQ--VVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQYDFNP 183
             L +ASIAQVHRA +V G +  VVVKVQH GI+ +++ D++N +    ++   + ++D + 
Sbjct:   139 LGSASIAQVHRA-IVKGNKMNVVVKVQHPGIERLMMTDIRNLQLFALYMQRTDIKFDLHS 197

Query:   184 IIDEWCKEAPKELDFNSEAENTRIVSANLGCKNKHEDSNKKPAYEVDVLIPEVIQSSET- 242
             I  E  K+   E DF  EA     +   L     +E++ K P     VL+P V++   T 
Sbjct:   198 ITKEMEKQIGYEFDFKREANAMERIRCFL-----YENNKKSP-----VLVPRVLRDMVTK 247

Query:   243 -VLILEFMDGIR-LNDCESLEAFGVN---------KQKVVEEITRAYAHQIYVDGFFNGD 291
              VL++E+++GI  L+  + +   G+N         K  ++  ++RAY   I   GFF+ D
Sbjct:   248 RVLVMEYINGIPILSIGDEMAKRGINPHGKIAEAAKHNILNSLSRAYGQMILKSGFFHAD 307

Query:   292 PHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLR 351
             PHPGN L+ K       LLD+G  K+L + ++   A +  A A+ +   +  +F EMGL 
Sbjct:   308 PHPGNILICKG--QEVALLDYGQVKELPNKLRLGYANLVIAMADNNASRVSQSFWEMGLH 365

Query:   352 LRLDVPEQAMEVSTLFFRTSAPANEAFETVKNLSEQRAKNLKVIQEKMKLNQKEVKRFNP 411
                    +  E+  L       A   F+T K  + Q      V+Q     +   +K+   
Sbjct:   366 TVAKCENEQQELLRL-------AQTLFDT-KMPTGQT-----VLQPFS--DDSSIKKI-A 409

Query:   412 VDAFPGDIVIFSRVLNLLRGLSSTMNVRIVYLDIMRPFAEYVL 454
             V+ FP ++    R + LLRGLS  M V     +  R  AE  L
Sbjct:   410 VETFPEELFSVLRTVVLLRGLSVGMGVNYSCAEQWRAMAEEAL 452
GO:0004672 "protein kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
GO:0009536 "plastid" evidence=IDA
TAIR|locus:2126793 AT4G24810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q86TW2 ADCK1 "Uncharacterized aarF domain-containing protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2009764 AT1G65950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177719 ATH13 "AT5G64940" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080401-5 adck1 "aarF domain containing kinase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSN4 ADCK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SE04 ADCK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYG8 ADCK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMT7 ADCK1 "Uncharacterized aarF domain-containing protein kinase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032357001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (859 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query685
COG0661517 COG0661, AarF, Predicted unusual protein kinase [G 4e-78
TIGR01982437 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase 8e-64
PRK04750537 PRK04750, ubiB, putative ubiquinone biosynthesis p 2e-50
pfam00144 326 pfam00144, Beta-lactamase, Beta-lactamase 1e-36
COG1680 390 COG1680, AmpC, Beta-lactamase class C and other pe 7e-27
pfam03109117 pfam03109, ABC1, ABC1 family 4e-26
PRK03642 432 PRK03642, PRK03642, putative periplasmic esterase; 7e-09
PRK11289 384 PRK11289, ampC, beta-lactamase/D-alanine carboxype 5e-08
PRK10662 378 PRK10662, PRK10662, beta-lactam binding protein Am 9e-06
PRK13128 518 PRK13128, PRK13128, D-aminopeptidase; Reviewed 1e-04
TIGR03724199 TIGR03724, arch_bud32, Kae1-associated kinase Bud3 6e-04
PRK10359232 PRK10359, PRK10359, lipopolysaccharide core biosyn 6e-04
PRK14879211 PRK14879, PRK14879, serine/threonine protein kinas 7e-04
pfam06176229 pfam06176, WaaY, Lipopolysaccharide core biosynthe 0.001
>gnl|CDD|223733 COG0661, AarF, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information 
 Score =  258 bits (661), Expect = 4e-78
 Identities = 130/427 (30%), Positives = 209/427 (48%), Gaps = 38/427 (8%)

Query: 32  KWIKKSKISALWQRAH--ERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQ 89
           + +     S L       E+ A+R+   + +L   ++KLGQ LSTR D++P  Y   L +
Sbjct: 37  RLLSWLGKSKLASSEELREKRAERLRLALEELGPTFIKLGQILSTRPDLVPPEYAEELAK 96

Query: 90  LQDSLPPRPVQEVSQTIEREFGESMGGMFMDFVETPLATASIAQVHRATLVDGRQVVVKV 149
           LQD +PP P +E  + IE E G  +  +F +F   P+A+ASIAQVHRA L  G +V VKV
Sbjct: 97  LQDRVPPFPFEEAERIIEEELGRPIEELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKV 156

Query: 150 QHQGIKTIILEDLKNAKSIVDWIAWAEPQ---YDFNPIIDEWCKEAPKELDFNSEAENTR 206
           Q  GI+  I  DLK  + +   I    P     D   ++DE+ K   +ELD+  EA N  
Sbjct: 157 QRPGIRERIEADLKLLRRLARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRREAANAE 216

Query: 207 IVSANLGCKNKHEDSNKKPAYEVDVLIPEVIQ--SSETVLILEFMDGIRLNDCESLEAFG 264
               N       +D         DV +P+V    ++  VL +E++DGI+++D  +L++ G
Sbjct: 217 RFRENF------KDDP-------DVYVPKVYWEYTTRRVLTMEWIDGIKISDIAALKSAG 263

Query: 265 VNKQKVVEEITRAYAHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQ 324
           ++++++ E + RA+  Q+  DGFF+ DPHPGN LV  D   R +LLDFG+  +L    ++
Sbjct: 264 IDRKELAELLVRAFLRQLLRDGFFHADPHPGNILVRSDG--RIVLLDFGIVGRLDPKFRR 321

Query: 325 ALAKMFFAAAEGDHVALLSAFAEMGLRLRLDVPEQAMEVSTLFFRTSAPANEAFETVKNL 384
            LA++  A    D+  +     E+G      VP       T     +A      E +   
Sbjct: 322 YLAELLLAFLNRDYDRVAELHVELGY-----VPPD-----TDRDPLAAAIRAVLEPIYGK 371

Query: 385 SEQRAKNLKVIQEKMKLNQKEVKRFNPVDAFPGDIVIFSRVLNLLRGLSSTMNVRIVYLD 444
                + +   +   KL +  V R  P+   P ++V+  R L L+ G+   ++ R     
Sbjct: 372 P---LEEISFGEILDKLFE--VARRFPMR-LPPELVLLQRTLLLVEGVGRQLDPRFNLWA 425

Query: 445 IMRPFAE 451
           + +P   
Sbjct: 426 VAQPLLA 432

Length = 517
>gnl|CDD|233667 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>gnl|CDD|235310 PRK04750, ubiB, putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>gnl|CDD|215746 pfam00144, Beta-lactamase, Beta-lactamase Back     alignment and domain information
>gnl|CDD|224594 COG1680, AmpC, Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|111949 pfam03109, ABC1, ABC1 family Back     alignment and domain information
>gnl|CDD|179620 PRK03642, PRK03642, putative periplasmic esterase; Provisional Back     alignment and domain information
>gnl|CDD|236894 PRK11289, ampC, beta-lactamase/D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>gnl|CDD|236732 PRK10662, PRK10662, beta-lactam binding protein AmpH; Provisional Back     alignment and domain information
>gnl|CDD|171868 PRK13128, PRK13128, D-aminopeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|234331 TIGR03724, arch_bud32, Kae1-associated kinase Bud32 Back     alignment and domain information
>gnl|CDD|182407 PRK10359, PRK10359, lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>gnl|CDD|237847 PRK14879, PRK14879, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|114869 pfam06176, WaaY, Lipopolysaccharide core biosynthesis protein (WaaY) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 685
COG0661517 AarF Predicted unusual protein kinase [General fun 100.0
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 100.0
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 100.0
KOG1235538 consensus Predicted unusual protein kinase [Genera 100.0
KOG1236565 consensus Predicted unusual protein kinase [Genera 100.0
KOG1234363 consensus ABC (ATP binding cassette) 1 protein [Ge 100.0
PRK11289 384 ampC beta-lactamase/D-alanine carboxypeptidase; Pr 100.0
PRK10662 378 beta-lactam binding protein AmpH; Provisional 100.0
PRK03642 432 putative periplasmic esterase; Provisional 100.0
PRK13128 518 D-aminopeptidase; Reviewed 100.0
PF00144 329 Beta-lactamase: Beta-lactamase; InterPro: IPR00146 100.0
COG1680 390 AmpC Beta-lactamase class C and other penicillin b 99.96
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 99.94
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.85
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.84
smart00090237 RIO RIO-like kinase. 99.76
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.73
KOG0595429 consensus Serine/threonine-protein kinase involved 99.71
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.69
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.68
KOG0605550 consensus NDR and related serine/threonine kinases 99.66
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 99.65
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 99.65
KOG0581364 consensus Mitogen-activated protein kinase kinase 99.62
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.62
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 99.59
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 99.59
PRK14879211 serine/threonine protein kinase; Provisional 99.59
PRK09188365 serine/threonine protein kinase; Provisional 99.58
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.58
KOG0661538 consensus MAPK related serine/threonine protein ki 99.57
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.56
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 99.55
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.55
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 99.53
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.52
PRK12274218 serine/threonine protein kinase; Provisional 99.51
KOG0575592 consensus Polo-like serine/threonine protein kinas 99.51
COG1718268 RIO1 Serine/threonine protein kinase involved in c 99.51
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.51
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 99.5
KOG0192362 consensus Tyrosine kinase specific for activated ( 99.5
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.49
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.49
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.49
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.48
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.48
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.48
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.48
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.47
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.47
KOG0598357 consensus Ribosomal protein S6 kinase and related 99.47
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.46
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 99.46
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.46
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.46
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.46
KOG0616355 consensus cAMP-dependent protein kinase catalytic 99.46
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.46
KOG0583370 consensus Serine/threonine protein kinase [Signal 99.46
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.46
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.46
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.46
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.45
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.45
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.45
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.45
COG0478304 RIO-like serine/threonine protein kinase fused to 99.45
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.45
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.45
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.45
KOG0663419 consensus Protein kinase PITSLRE and related kinas 99.45
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.45
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.45
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.45
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.44
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.44
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.44
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.44
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.44
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.44
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.44
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.44
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.43
KOG0578550 consensus p21-activated serine/threonine protein k 99.43
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.43
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.43
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.43
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.43
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.43
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.43
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.42
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.42
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.42
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.42
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.41
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.41
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.41
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.41
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.41
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.41
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.41
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.41
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.4
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.39
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.39
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.39
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.39
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.38
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.38
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.38
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.38
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 99.38
KOG0660359 consensus Mitogen-activated protein kinase [Signal 99.37
KOG0198313 consensus MEKK and related serine/threonine protei 99.37
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.37
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.37
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.37
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.37
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.36
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.36
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 99.36
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.36
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.36
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.36
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.36
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.35
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.35
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.35
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.35
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.35
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.35
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.34
PTZ00267478 NIMA-related protein kinase; Provisional 99.34
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.34
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.34
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.34
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.34
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.34
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.34
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.34
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.34
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.34
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.34
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.34
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.33
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.33
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.33
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.33
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.33
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.33
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.33
KOG0611668 consensus Predicted serine/threonine protein kinas 99.33
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.32
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.32
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.32
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.32
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.32
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.32
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.31
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.31
KOG0201467 consensus Serine/threonine protein kinase [Signal 99.31
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.31
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.31
KOG0582516 consensus Ste20-like serine/threonine protein kina 99.31
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.31
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.31
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.31
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.31
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.31
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.31
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.31
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.3
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.3
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.3
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.3
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.3
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.3
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.3
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.3
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.3
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.3
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.29
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.29
PTZ00283496 serine/threonine protein kinase; Provisional 99.29
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.29
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.29
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.29
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.29
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.28
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.28
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.28
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.28
KOG0610459 consensus Putative serine/threonine protein kinase 99.28
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.28
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.28
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.28
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.28
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.28
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.28
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.28
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.28
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.28
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.28
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.27
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.27
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.27
PHA03211461 serine/threonine kinase US3; Provisional 99.27
PHA03209357 serine/threonine kinase US3; Provisional 99.27
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.27
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.27
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.27
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.27
PRK10345210 hypothetical protein; Provisional 99.27
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.27
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 99.26
PHA03212391 serine/threonine kinase US3; Provisional 99.26
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 99.26
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.26
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.26
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.26
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.26
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.26
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.26
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.26
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.26
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.26
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.26
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.25
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.25
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.25
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.25
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.25
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.25
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.25
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.25
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.25
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.25
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.25
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.25
PTZ00036440 glycogen synthase kinase; Provisional 99.24
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.24
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.24
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.24
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.24
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.24
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.24
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.24
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.24
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.24
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.24
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.24
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.24
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.24
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.24
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.23
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.23
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.23
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.23
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.23
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.23
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.23
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.23
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.23
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.23
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.23
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.23
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.23
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.23
PHA02988283 hypothetical protein; Provisional 99.23
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.22
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.22
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.22
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.22
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.22
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.22
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.22
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.22
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.22
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.22
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.22
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.22
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.21
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.21
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.21
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.21
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.21
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.21
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.21
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.21
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.21
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.2
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.2
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.2
PTZ00284467 protein kinase; Provisional 99.2
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.2
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.2
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.2
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.2
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.2
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.2
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.2
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.19
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.19
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.19
PHA03207392 serine/threonine kinase US3; Provisional 99.19
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.19
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.19
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.19
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.19
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.19
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.19
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.19
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.18
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.18
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.17
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.17
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.17
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.17
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.17
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.17
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.16
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.16
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.16
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.16
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.16
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.16
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.16
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.16
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.16
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.16
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.15
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.15
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.15
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.15
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.15
PLN03224507 probable serine/threonine protein kinase; Provisio 99.15
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.15
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.15
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.15
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.14
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.14
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.14
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.14
KOG1167418 consensus Serine/threonine protein kinase of the C 99.14
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.14
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.14
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.14
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.14
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.13
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.13
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.13
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.13
PLN00009294 cyclin-dependent kinase A; Provisional 99.13
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.12
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.12
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.12
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.12
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.12
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.12
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.12
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.11
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.11
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.11
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.11
KOG0589426 consensus Serine/threonine protein kinase [General 99.1
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.1
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.1
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.09
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.09
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.09
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.09
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.09
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.09
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.09
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.08
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.08
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.08
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.07
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.06
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.06
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.06
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.05
PHA02882294 putative serine/threonine kinase; Provisional 99.05
KOG0586596 consensus Serine/threonine protein kinase [General 99.05
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.05
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.05
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.04
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.03
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.03
KOG3087229 consensus Serine/threonine protein kinase [General 99.03
PHA03210501 serine/threonine kinase US3; Provisional 99.02
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.02
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.01
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.01
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.01
KOG0596677 consensus Dual specificity; serine/threonine and t 99.01
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.0
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.0
KOG2270520 consensus Serine/threonine protein kinase involved 98.99
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 98.99
KOG3653534 consensus Transforming growth factor beta/activin 98.98
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 98.98
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 98.97
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 98.96
KOG4717 864 consensus Serine/threonine protein kinase [Signal 98.96
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.95
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 98.94
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 98.94
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 98.94
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 98.91
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.91
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 98.9
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 98.89
KOG2052513 consensus Activin A type IB receptor, serine/threo 98.85
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 98.84
KOG0690516 consensus Serine/threonine protein kinase [Signal 98.84
KOG0696683 consensus Serine/threonine protein kinase [Signal 98.83
KOG1151775 consensus Tousled-like protein kinase [Signal tran 98.83
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 98.82
KOG0986591 consensus G protein-coupled receptor kinase [Signa 98.81
KOG0607463 consensus MAP kinase-interacting kinase and relate 98.8
KOG1027903 consensus Serine/threonine protein kinase and endo 98.77
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.76
KOG1152772 consensus Signal transduction serine/threonine kin 98.75
KOG10251177 consensus Epidermal growth factor receptor EGFR an 98.74
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 98.73
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 98.73
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 98.72
PRK10593297 hypothetical protein; Provisional 98.71
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 98.7
KOG1345378 consensus Serine/threonine kinase [Signal transduc 98.7
KOG2268465 consensus Serine/threonine protein kinase [Signal 98.68
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.68
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.67
KOG4257974 consensus Focal adhesion tyrosine kinase FAK, cont 98.67
KOG1026774 consensus Nerve growth factor receptor TRKA and re 98.67
PLN00113968 leucine-rich repeat receptor-like protein kinase; 98.6
KOG0695593 consensus Serine/threonine protein kinase [Signal 98.56
PRK09550401 mtnK methylthioribose kinase; Reviewed 98.51
KOG0671415 consensus LAMMER dual specificity kinases [Signal 98.5
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 98.45
PF01636239 APH: Phosphotransferase enzyme family This family 98.45
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 98.43
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 98.41
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 98.4
PRK05231319 homoserine kinase; Provisional 98.37
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 98.37
PRK12396409 5-methylribose kinase; Reviewed 98.34
PLN02756418 S-methyl-5-thioribose kinase 98.32
COG0515384 SPS1 Serine/threonine protein kinase [General func 98.3
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 98.3
KOG0584632 consensus Serine/threonine protein kinase [General 98.26
KOG0200609 consensus Fibroblast/platelet-derived growth facto 98.23
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 98.21
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 98.2
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 98.16
PRK06148 1013 hypothetical protein; Provisional 98.05
PRK09902216 hypothetical protein; Provisional 98.0
PLN00181 793 protein SPA1-RELATED; Provisional 97.96
KOG1290590 consensus Serine/threonine protein kinase [Signal 97.96
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 97.95
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 97.95
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 97.94
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 97.9
PLN02876 822 acyl-CoA dehydrogenase 97.84
TIGR01767370 MTRK 5-methylthioribose kinase. This enzyme is inv 97.84
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 97.83
COG2334331 Putative homoserine kinase type II (protein kinase 97.81
COG3001286 Uncharacterized protein conserved in bacteria [Fun 97.68
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 97.68
PLN02236344 choline kinase 97.6
PRK06149 972 hypothetical protein; Provisional 97.6
PRK11768325 serine/threonine protein kinase; Provisional 97.58
KOG2269531 consensus Serine/threonine protein kinase [Signal 97.3
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 97.18
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 96.94
PF04655253 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic r 96.86
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 96.85
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 96.8
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 96.54
KOG0590601 consensus Checkpoint kinase and related serine/thr 96.47
PTZ00384383 choline kinase; Provisional 95.99
PRK10271188 thiK thiamine kinase; Provisional 95.72
COG1686 389 DacC D-alanyl-D-alanine carboxypeptidase [Cell env 95.58
PF00768240 Peptidase_S11: D-alanyl-D-alanine carboxypeptidase 95.53
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 95.53
PTZ00296442 choline kinase; Provisional 95.26
PRK15442284 beta-lactamase TEM; Provisional 95.05
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 94.66
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 94.45
PRK10793 403 D-alanyl-D-alanine carboxypeptidase fraction A; Pr 94.16
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domai 94.04
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 93.87
PRK11397 388 dacD D-alanyl-D-alanine carboxypeptidase; Provisio 93.73
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 93.7
COG5072488 ALK1 Serine/threonine kinase of the haspin family 93.67
KOG0590601 consensus Checkpoint kinase and related serine/thr 92.93
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-77  Score=655.50  Aligned_cols=385  Identities=32%  Similarity=0.550  Sum_probs=343.0

Q ss_pred             HHHHHHHHHHHHHHHHhccchhHhHHHHHhcCCCCCCHHHHHHHHHHhhcCCCCCHHHHHHHHHHHhCCChhhhccccCC
Q 005658           44 QRAHERNAKRVLNLIIKLEGLWVKLGQYLSTRADVLPEPYISLLKQLQDSLPPRPVQEVSQTIEREFGESMGGMFMDFVE  123 (685)
Q Consensus        44 ~~~~~~~a~~l~~~l~~lg~~~iK~gQ~ls~r~dllp~~~~~~l~~l~d~~~~~~~~~~~~~~~~~~g~~~~~~f~~~~~  123 (685)
                      ++..++.+++|+++|++|||+|||+||+||||+|++|++|+++|++|||+|||+|++++++++++++|.+++++|++|++
T Consensus        51 ~~~~~~~~~rL~~~L~~LGPtfIK~GQ~LStR~Dl~p~e~~~eL~~LQD~vpp~~~~~~~~iie~eLG~~iee~F~eF~~  130 (517)
T COG0661          51 EELREKRAERLRLALEELGPTFIKLGQILSTRPDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPIEELFSEFEP  130 (517)
T ss_pred             HHHhHhHHHHHHHHHHHhCCchhhhhhHHhcCccccCHHHHHHHHHhhcCCCCCCHHHHHHHHHHHhCCCHHHHHHHcCC
Confidence            34567789999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccceeeeeEEEEecCCCEEEEEeeCCChHHHHHHHHHHHHHHHHHHHhhCCC---CChHHHHHHHHHhchhhhcHHH
Q 005658          124 TPLATASIAQVHRATLVDGRQVVVKVQHQGIKTIILEDLKNAKSIVDWIAWAEPQ---YDFNPIIDEWCKEAPKELDFNS  200 (685)
Q Consensus       124 ~pi~sgSigqV~~A~l~~G~~VaVKv~~p~~~~~~~~dl~~l~~l~~~~~~~~~~---~~~~~~~~e~~~~l~~Eld~~~  200 (685)
                      +|||+||+||||+|++++|+.|||||||||+++.+..|+.+++.+++++.+..+.   +++..+++||.+.+..|+||++
T Consensus       131 ~PiAsASIaQVH~A~L~sG~~VAVKVqrPgi~~~i~~DL~il~~~a~~~~~~~~~~~~l~~~~vv~e~~~~l~~ElDy~~  210 (517)
T COG0661         131 EPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEADLKLLRRLARLIKRLPPGGRRLDLVEVVDEFEKRLREELDYRR  210 (517)
T ss_pred             CchhhhhHhhheeEEecCCCEEEEEecCCChHHHHHHHHHHHHHHHHHHHHcCCccccCChHHHHHHHHHHHHHHhCHHH
Confidence            9999999999999999999999999999999999999999999999999987776   8999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCCCCCCCCCCCCCCCcceeeceeee--cCCCeeEeeccCCccCCChhHHHHcCCCHHHHHHHHHHHH
Q 005658          201 EAENTRIVSANLGCKNKHEDSNKKPAYEVDVLIPEVIQ--SSETVLILEFMDGIRLNDCESLEAFGVNKQKVVEEITRAY  278 (685)
Q Consensus       201 Ea~n~~~~~~~~~~~~~~~~~~~~~~~~~~v~vP~v~~--~~~~vLvmE~i~G~~L~~~~~~~~~~~~~~~i~~~l~~~~  278 (685)
                      ||+|+++|+++|+             +.+.++||+|||  |+++||||||++|.++++...++..|.|.+.+++.++++|
T Consensus       211 EA~n~~~~~~nf~-------------~~~~v~VP~V~we~t~~~VLtmE~i~Gi~i~d~~~l~~~g~d~k~ia~~~~~~f  277 (517)
T COG0661         211 EAANAERFRENFK-------------DDPDVYVPKVYWEYTTRRVLTMEWIDGIKISDIAALKSAGIDRKELAELLVRAF  277 (517)
T ss_pred             HHHHHHHHHHHcC-------------CCCCeEeceeehhccCCcEEEEEeeCCEecccHHHHHhcCCCHHHHHHHHHHHH
Confidence            9999999999987             567899999997  8999999999999999999999999999999999999999


Q ss_pred             HHHhhhcCccccCCCccceEEeeCCCCceEEEecccccccCHHHHHHHHHHHHHHHcCCHHHHHHHHHHcCcccC-CCch
Q 005658          279 AHQIYVDGFFNGDPHPGNFLVSKDPPHRPILLDFGLTKKLSSSMKQALAKMFFAAAEGDHVALLSAFAEMGLRLR-LDVP  357 (685)
Q Consensus       279 l~~i~~~g~~H~D~hPgNilv~~~~~~~i~LiDFG~~~~l~~~~r~~~~~l~~a~~~~d~~~~~~~~~~~g~~~~-~~~~  357 (685)
                      ++|++.+||||||||||||+|+  ++|+++++|||+++++++++|..+++++.++.++|++.+++.+.++|.... .+..
T Consensus       278 ~~q~~~dgffHaDpHpGNi~v~--~~g~i~~lDfGi~g~l~~~~r~~l~~~~~a~~~rD~~~v~~~~~~~G~~~~~~~~~  355 (517)
T COG0661         278 LRQLLRDGFFHADPHPGNILVR--SDGRIVLLDFGIVGRLDPKFRRYLAELLLAFLNRDYDRVAELHVELGYVPPDTDRD  355 (517)
T ss_pred             HHHHHhcCccccCCCccceEEe--cCCcEEEEcCcceecCCHHHHHHHHHHHHHHHhhCHHHHHHHHHHhCCCCCccchH
Confidence            9999999999999999999999  459999999999999999999999999999999999999999999999853 3555


Q ss_pred             HHHHHHHHHHhhcC-CChhhhHHHHhhhHHHHHHhHHHHHHHHHhhHHHHhhcCCCCCCcchhHHHHhHHHHHHHhHhcc
Q 005658          358 EQAMEVSTLFFRTS-APANEAFETVKNLSEQRAKNLKVIQEKMKLNQKEVKRFNPVDAFPGDIVIFSRVLNLLRGLSSTM  436 (685)
Q Consensus       358 ~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~~~~~R~~~~l~g~~~~L  436 (685)
                      ....++..++-... .+..       .++.     .+.+....    +...+|+  +++|++++++.|++.++||++++|
T Consensus       356 ~~~~~i~~~~~~~~~~~~~-------~~~~-----~~~~~~~~----~~~~~~~--~r~p~~l~ll~r~~~~vEg~~~~l  417 (517)
T COG0661         356 PLAAAIRAVLEPIYGKPLE-------EISF-----GEILDKLF----EVARRFP--MRLPPELVLLQRTLLLVEGVGRQL  417 (517)
T ss_pred             HHHHHHHHHHHhhhCCChh-------hccH-----HHHHHHHH----HHHHhcC--ccCCHHHHHHHHHHHHHHHHHHhh
Confidence            55544443332111 1111       1111     01111111    1133444  789999999999999999999999


Q ss_pred             CCchhhHHhHHHHHHHHHHhccCCC
Q 005658          437 NVRIVYLDIMRPFAEYVLQVGINKE  461 (685)
Q Consensus       437 ~p~~~~~~~~~p~~~~~l~~~l~~~  461 (685)
                      ||++|+++++.||+.+....++++.
T Consensus       418 dp~~~~~~~a~p~~~~~~~~~~~~~  442 (517)
T COG0661         418 DPRFNLWAVAQPLLAKWLKKQLSPK  442 (517)
T ss_pred             CccccHHHHhhHHHHHHHHHhhhHH
Confidence            9999999999999999998887765

>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG1236 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG1234 consensus ABC (ATP binding cassette) 1 protein [General function prediction only] Back     alignment and domain information
>PRK11289 ampC beta-lactamase/D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>PRK10662 beta-lactam binding protein AmpH; Provisional Back     alignment and domain information
>PRK03642 putative periplasmic esterase; Provisional Back     alignment and domain information
>PRK13128 D-aminopeptidase; Reviewed Back     alignment and domain information
>PF00144 Beta-lactamase: Beta-lactamase; InterPro: IPR001466 This entry represents the serine beta-lactamase-like superfamily Back     alignment and domain information
>COG1680 AmpC Beta-lactamase class C and other penicillin binding proteins [Defense mechanisms] Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG2269 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF04655 APH_6_hur: Aminoglycoside/hydroxyurea antibiotic resistance kinase; InterPro: IPR006748 The aminoglycosides are a large group of biologically active bacterial secondary metabolites, best known for their antibiotic properties [] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00384 choline kinase; Provisional Back     alignment and domain information
>PRK10271 thiK thiamine kinase; Provisional Back     alignment and domain information
>COG1686 DacC D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00768 Peptidase_S11: D-alanyl-D-alanine carboxypeptidase This is family S11 in the peptidase classification Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00296 choline kinase; Provisional Back     alignment and domain information
>PRK15442 beta-lactamase TEM; Provisional Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10793 D-alanyl-D-alanine carboxypeptidase fraction A; Provisional Back     alignment and domain information
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PRK11397 dacD D-alanyl-D-alanine carboxypeptidase; Provisional Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query685
3zyt_A 372 Structure Determination Of Esta From Arthrobacter N 2e-15
2qmi_A 447 Structure Of The Octameric Penicillin-Binding Prote 6e-13
1ci9_A 392 Dfp-Inhibited Esterase Estb From Burkholderia Gladi 5e-12
1l0f_A 358 X-Ray Crystal Structure Of Ampc N152h Mutant Beta-L 5e-08
2wzx_A 371 Amp-C Beta-Lactamase (Pseudomonas Aeruginosa)in Com 8e-08
3s1y_A 371 Amp-C Beta-Lactamase (Pseudomonas Aeruginosa) In Co 8e-08
1i5q_A 358 Crystal Structure Of The E. Coli Ampc Beta-Lactamas 1e-07
1pi4_A 358 Structure Of N289a Mutant Of Ampc In Complex With S 1e-07
3iwi_A 361 X-Ray Crystal Structure Of The Extended-Spectrum Am 1e-07
3iwq_B 358 X-Ray Crystal Structure Of The Extended-Spectrum Am 1e-07
1fsw_A 358 Ampc Beta-Lactamase From E. Coli Complexed With Inh 1e-07
2p9v_A 358 Structure Of Ampc Beta-Lactamase With Cross-Linked 1e-07
2bls_A 358 Ampc Beta-Lactamase From Escherichia Coli Length = 1e-07
3ixd_A 358 X-Ray Crystal Structure Of The Extended-Spectrum Am 1e-07
2ffy_B 358 Ampc Beta-Lactamase N289a Mutant In Complex With A 2e-07
1sde_A 347 Toward Better Antibiotics: Crystal Structure Of D-A 2e-07
1hvb_A 349 Crystal Structure Of Streptomyces R61 Dd-Peptidase 2e-07
3iwo_A 358 X-Ray Crystal Structure Of The Extended-Spectrum Am 2e-07
2qz6_A 358 First Crystal Structure Of A Psychrophile Class C B 2e-07
3fkv_A 358 Ampc K67r Mutant Complexed With Benzo(B)thiophene-2 3e-07
1l0e_A 358 X-Ray Crystal Structure Of Ampc K67q Mutant Beta-La 4e-07
1kvl_A 358 X-Ray Crystal Structure Of Ampc S64g Mutant Beta-La 4e-07
1l0d_A 358 X-Ray Crystal Structure Of Ampc S64d Mutant Beta-La 5e-07
1bls_A 361 Crystallographic Structure Of A Phosphonate Derivat 5e-07
1rgz_A 363 Enterobacter Cloacae Gc1 Class C Beta-Lactamase Com 5e-07
2q9m_A 359 4-Substituted Trinems As Broad Spectrum-Lactamase I 5e-07
1gce_A 364 Structure Of The Beta-Lactamase Of Enterobacter Clo 5e-07
1fr1_A 361 Refined Crystal Structure Of Beta-Lactamase From Ci 6e-07
3s4x_A 367 Crystal Structure Of The Asn152gly Mutant Of P99 Be 6e-07
3ixg_A 358 X-Ray Crystal Structure Of The Extended-Spectrum Am 8e-07
2zj9_A 355 X-Ray Crystal Structure Of Ampc Beta-Lactamase (Amp 1e-06
1zc2_A 361 Crystal Structure Of Plasmid-Encoded Class C Beta-L 1e-06
2dns_A 363 The Crystal Structure Of D-Amino Acid Amidase From 1e-06
1s6r_A 359 908r Class C Beta-Lactamase Bound To Iodo-Acetamido 1e-06
1y54_A 361 Crystal Structure Of The Native Class C Beta-Lactam 1e-06
1rgy_A 360 Citrobacter Freundii Gn346 Class C Beta-Lactamase C 1e-06
2zc7_A 359 Crystal Structure Of Class C Beta-Lactamase Act-1 L 2e-06
3ozh_A 351 Crystal Structure Of Beta-LactamaseD-Alanine Carbox 2e-06
1fcm_A 358 Crystal Structure Of The E.Coli Ampc Beta-Lactamase 3e-06
3o3v_A 335 Crystal Structure Of Clbp Peptidase Domain Length = 5e-06
4gdn_A 342 Structure Of Fmta-Like Protein Length = 342 2e-05
3hlc_A 432 Simvastatin Synthase (Lovd) From Aspergillus Terreu 6e-05
3hle_A 432 Simvastatin Synthase (Lovd), From Aspergillus Terre 1e-04
3hl9_A 432 Simvastatin Synthase (Lovd) From Aspergillus Terreu 1e-04
>pdb|3ZYT|A Chain A, Structure Determination Of Esta From Arthrobacter Nitroguajacolicus Rue61a Length = 372 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 84/173 (48%), Gaps = 12/173 (6%)
Query: 499 QVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKLEE 558
           QV AY  G  ++D S G      P  ++PDS+  VFS +KG+   ++  LV +G+L LE 
Sbjct: 30  QVAAYHRGVKVLDLSGG------PH-IRPDSVTGVFSCSKGMAGLVMALLVQDGELDLEA 82
Query: 559 NIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPE 618
            +   WPEF   GK  I V  +L+H +GL  V   L+      + + +    ++A   P 
Sbjct: 83  EVVKYWPEFGVEGKSSITVAQLLSHRAGLLGVEGGLTLHE---VNNSELAAAKLAELPPL 139
Query: 619 TEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIP 671
            +PG    YH L+ G     +  R +G   QE+ E+ I      +   Y+G+P
Sbjct: 140 WKPGTAFGYHALTIGIFMEELCRRITGSTLQEVFEQRIRAVTGAN--FYLGLP 190
>pdb|2QMI|A Chain A, Structure Of The Octameric Penicillin-Binding Protein Homologue From Pyrococcus Abyssi Length = 447 Back     alignment and structure
>pdb|1CI9|A Chain A, Dfp-Inhibited Esterase Estb From Burkholderia Gladioli Length = 392 Back     alignment and structure
>pdb|1L0F|A Chain A, X-Ray Crystal Structure Of Ampc N152h Mutant Beta-Lactamase Length = 358 Back     alignment and structure
>pdb|2WZX|A Chain A, Amp-C Beta-Lactamase (Pseudomonas Aeruginosa)in Complex With Compound M-02 Length = 371 Back     alignment and structure
>pdb|3S1Y|A Chain A, Amp-C Beta-Lactamase (Pseudomonas Aeruginosa) In Complex With A Beta- Lactamase Inhibitor Length = 371 Back     alignment and structure
>pdb|1I5Q|A Chain A, Crystal Structure Of The E. Coli Ampc Beta-Lactamase Mutant N152a Covalently Acylated With The Inhibitory Beta-Lactam, Moxalactam Length = 358 Back     alignment and structure
>pdb|1PI4|A Chain A, Structure Of N289a Mutant Of Ampc In Complex With Sm3, A Phenylglyclboronic Acid Bearing The Cephalothin R1 Side Chain Length = 358 Back     alignment and structure
>pdb|3IWI|A Chain A, X-Ray Crystal Structure Of The Extended-Spectrum Ampc Omega Loop Insertion (H210aaa) Mutant Beta-Lactamase At 1.64 Angstrom Resolution Length = 361 Back     alignment and structure
>pdb|3IWQ|B Chain B, X-Ray Crystal Structure Of The Extended-Spectrum Ampc E219k Mutant Beta-Lactamase At 1.84 Angstrom Resolution Length = 358 Back     alignment and structure
>pdb|1FSW|A Chain A, Ampc Beta-Lactamase From E. Coli Complexed With Inhibitor Cephalothinboronic Acid Length = 358 Back     alignment and structure
>pdb|2P9V|A Chain A, Structure Of Ampc Beta-Lactamase With Cross-Linked Active Site After Exposure To Small Molecule Inhibitor Length = 358 Back     alignment and structure
>pdb|2BLS|A Chain A, Ampc Beta-Lactamase From Escherichia Coli Length = 358 Back     alignment and structure
>pdb|3IXD|A Chain A, X-Ray Crystal Structure Of The Extended-Spectrum Ampc V298e Mutant Beta-Lactamase At 2.64 Angstrom Resolution Length = 358 Back     alignment and structure
>pdb|2FFY|B Chain B, Ampc Beta-Lactamase N289a Mutant In Complex With A Boronic Acid Deacylation Transition State Analog Compound Sm3 Length = 358 Back     alignment and structure
>pdb|1SDE|A Chain A, Toward Better Antibiotics: Crystal Structure Of D-Ala-D-Ala Peptidase Inhibited By A Novel Bicyclic Phosphate Inhibitor Length = 347 Back     alignment and structure
>pdb|1HVB|A Chain A, Crystal Structure Of Streptomyces R61 Dd-Peptidase Complexed With A Novel Cephalosporin Analog Of Cell Wall Peptidoglycan Length = 349 Back     alignment and structure
>pdb|3IWO|A Chain A, X-Ray Crystal Structure Of The Extended-Spectrum Ampc Y221g Mutant Beta-Lactamase At 1.90 Angstrom Resolution Length = 358 Back     alignment and structure
>pdb|2QZ6|A Chain A, First Crystal Structure Of A Psychrophile Class C Beta- Lactamase Length = 358 Back     alignment and structure
>pdb|3FKV|A Chain A, Ampc K67r Mutant Complexed With Benzo(B)thiophene-2-Boronic Acid (Bzb) Length = 358 Back     alignment and structure
>pdb|1L0E|A Chain A, X-Ray Crystal Structure Of Ampc K67q Mutant Beta-Lactamase Length = 358 Back     alignment and structure
>pdb|1KVL|A Chain A, X-Ray Crystal Structure Of Ampc S64g Mutant Beta-Lactamase In Complex With Substrate And Product Forms Of Cephalothin Length = 358 Back     alignment and structure
>pdb|1L0D|A Chain A, X-Ray Crystal Structure Of Ampc S64d Mutant Beta-Lactamase Length = 358 Back     alignment and structure
>pdb|1BLS|A Chain A, Crystallographic Structure Of A Phosphonate Derivative Of The Enterobacter Cloacae P99 Cephalosporinase: Mechanistic Interpretation Of A Beta-Lactamase Transition State Analog Length = 361 Back     alignment and structure
>pdb|1RGZ|A Chain A, Enterobacter Cloacae Gc1 Class C Beta-Lactamase Complexed With Transition-State Analog Of Cefotaxime Length = 363 Back     alignment and structure
>pdb|2Q9M|A Chain A, 4-Substituted Trinems As Broad Spectrum-Lactamase Inhibitors: Structure-Based Design, Synthesis And Biological Activity Length = 359 Back     alignment and structure
>pdb|1GCE|A Chain A, Structure Of The Beta-Lactamase Of Enterobacter Cloacae Gc1 Length = 364 Back     alignment and structure
>pdb|1FR1|A Chain A, Refined Crystal Structure Of Beta-Lactamase From Citrobacter Freundii Indicates A Mechanism For Beta-Lactam Hydrolysis Length = 361 Back     alignment and structure
>pdb|3S4X|A Chain A, Crystal Structure Of The Asn152gly Mutant Of P99 Beta-lactamase Length = 367 Back     alignment and structure
>pdb|3IXG|A Chain A, X-Ray Crystal Structure Of The Extended-Spectrum Ampc T70i Mutant Beta-Lactamase With And Without Benzo(B)thiophene-2- Boronic Acid Bound At 2.14 Angstrom Resolution Length = 358 Back     alignment and structure
>pdb|2ZJ9|A Chain A, X-Ray Crystal Structure Of Ampc Beta-Lactamase (Ampc(D)) From An Escherichia Coli With A Tripeptide Deletion (Gly286 Ser287 Asp288) On The H10 Helix Length = 355 Back     alignment and structure
>pdb|1ZC2|A Chain A, Crystal Structure Of Plasmid-Encoded Class C Beta-Lactamase Cmy-2 Complexed With Citrate Molecule Length = 361 Back     alignment and structure
>pdb|2DNS|A Chain A, The Crystal Structure Of D-Amino Acid Amidase From Ochrobactrum Anthropi Sv3 Complexed With D-Phenylalanine Length = 363 Back     alignment and structure
>pdb|1S6R|A Chain A, 908r Class C Beta-Lactamase Bound To Iodo-Acetamido-Phenyl Boronic Acid Length = 359 Back     alignment and structure
>pdb|1Y54|A Chain A, Crystal Structure Of The Native Class C Beta-Lactamase From Enterobacter Cloacae 908r Complexed With Brl42715 Length = 361 Back     alignment and structure
>pdb|1RGY|A Chain A, Citrobacter Freundii Gn346 Class C Beta-Lactamase Complexed With Transition-State Analog Of Cefotaxime Length = 360 Back     alignment and structure
>pdb|2ZC7|A Chain A, Crystal Structure Of Class C Beta-Lactamase Act-1 Length = 359 Back     alignment and structure
>pdb|3OZH|A Chain A, Crystal Structure Of Beta-LactamaseD-Alanine Carboxypeptidase From Yersinia Pestis Length = 351 Back     alignment and structure
>pdb|1FCM|A Chain A, Crystal Structure Of The E.Coli Ampc Beta-Lactamase Mutant Q120lY150E Covalently Acylated With The Inhibitory Beta-Lactam, Cloxacillin Length = 358 Back     alignment and structure
>pdb|3O3V|A Chain A, Crystal Structure Of Clbp Peptidase Domain Length = 335 Back     alignment and structure
>pdb|4GDN|A Chain A, Structure Of Fmta-Like Protein Length = 342 Back     alignment and structure
>pdb|3HLC|A Chain A, Simvastatin Synthase (Lovd) From Aspergillus Terreus, S5 Mutant, Unliganded Length = 432 Back     alignment and structure
>pdb|3HLE|A Chain A, Simvastatin Synthase (Lovd), From Aspergillus Terreus, S5 Mutant, S76a Mutant, Complex With Monacolin J Acid Length = 432 Back     alignment and structure
>pdb|3HL9|A Chain A, Simvastatin Synthase (Lovd) From Aspergillus Terreus, Unliganded Length = 432 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query685
2qz6_A 358 Beta-lactamase; psychrophIle, cold adaptation, ant 5e-33
2wzx_A 371 Beta-lactamase; inhibitor, hydrolase, antibiotic r 1e-32
2ffy_A 358 Beta-lactamase; AMPC, deacylation, transition stat 5e-31
1zkj_A 359 CMY-10, extended-spectrum beta-lactamase; plasmid, 9e-31
1ci9_A 392 ESTB, protein (carboxylesterase); hydrolase, cabox 2e-30
2drw_A 363 DAA, D-amino acid amidase; penicillin recognizing 6e-29
3rju_A 351 Beta-lactamase/D-alanine carboxypeptidase; structu 2e-28
1yqs_A 349 D-alanyl-D-alanine carboxypeptidase; cell well bio 2e-27
3o3v_A 335 Beta-lactamase, CLBP protein; alpha/beta, disulfid 4e-27
2qmi_A 447 PBP related beta-lactamase; PAB87, octamer, LU-HPD 6e-27
1ei5_A 520 D-aminopeptidase, DAP; penicillin binding protein, 2e-25
3tg9_A 356 Penicillin-binding protein; structural genomics, P 3e-25
3hlc_A 432 Transesterase, LOVD; alpha/beta hydrolase fold, tr 3e-23
2dcf_A 392 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1. 2e-20
4gb7_A 422 6-aminohexanoate-dimer hydrolase; structural genom 1e-19
3i7j_A 280 Beta-lactamase MB2281C; alpha-beta protein., struc 5e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
>2qz6_A Beta-lactamase; psychrophIle, cold adaptation, antibiotic resistance, hydrolase, periplasm; 2.26A {Pseudomonas fluorescens} Length = 358 Back     alignment and structure
 Score =  129 bits (326), Expect = 5e-33
 Identities = 41/185 (22%), Positives = 88/185 (47%), Gaps = 8/185 (4%)

Query: 476 SDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFS 535
           +D+   +   +  L     I G+ V   ++G+     + G+  +   +P+  ++LF + S
Sbjct: 2   TDIRQVVDSTVEPLMQQQDIAGLSVAVIQNGKAQY-FNYGVANKDSKQPITENTLFEIGS 60

Query: 536 VTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLS 595
           V+K  TA +  + + NGKLKL +  +   P  + +  D I + ++  +T+G   +     
Sbjct: 61  VSKTFTATLAGYALANGKLKLSDPASQYLPALRGDKFDHISLLNLGTYTAGGLPLQFPEE 120

Query: 596 SENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGIIERASGKKFQEILEEG 655
           S+N        + ++      P   PG ++LY   S G L G +  ++ G+ F++++E+ 
Sbjct: 121 SDNT------GKMISYYQHWKPAFAPGTQRLYSNPSIG-LFGHLAAQSLGQPFEKLMEQT 173

Query: 656 IIQPL 660
           ++  L
Sbjct: 174 VLPKL 178
>2wzx_A Beta-lactamase; inhibitor, hydrolase, antibiotic resistance; HET: ZX0; 1.40A {Pseudomonas aeruginosa} PDB: 2wzz_A* 3s1y_A* 3s22_A* Length = 371 Back     alignment and structure
>2ffy_A Beta-lactamase; AMPC, deacylation, transition state, boronic acid, hydrolase; HET: SM3; 1.07A {Escherichia coli} SCOP: e.3.1.1 PDB: 1pi5_A* 1pi4_A* 2hds_A* 1c3b_A* 1fco_A* 1ga9_A* 1iem_A* 1kds_A* 1kdw_A* 1ke0_A* 1ke3_A* 1iel_A 1kvm_A* 1l2s_A* 1ll5_A* 1ll9_A* 1llb_A* 1mxo_A* 1my8_A* 1xgi_A* ... Length = 358 Back     alignment and structure
>1zkj_A CMY-10, extended-spectrum beta-lactamase; plasmid, class C, hydrolase; 1.55A {Enterobacter aerogenes} Length = 359 Back     alignment and structure
>1ci9_A ESTB, protein (carboxylesterase); hydrolase, caboxylesterase; HET: DFP; 1.80A {Burkholderia gladioli} SCOP: e.3.1.1 PDB: 1ci8_A* Length = 392 Back     alignment and structure
>2drw_A DAA, D-amino acid amidase; penicillin recognizing protein, D-stereospecific, hydrophobic, hydrolase; 2.10A {Ochrobactrum anthropi} SCOP: e.3.1.1 PDB: 2dns_A 2efu_A* 2efx_A* Length = 363 Back     alignment and structure
>3rju_A Beta-lactamase/D-alanine carboxypeptidase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich; HET: MSE CIT; 1.50A {Yersinia pestis} PDB: 3ozh_A* Length = 351 Back     alignment and structure
>1yqs_A D-alanyl-D-alanine carboxypeptidase; cell well biosynthesis, beta-lactam, beta-sultam, sulfonylation, hydrolase; HET: BSA; 1.05A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1cef_A* 1ceg_A* 1ikg_A* 1iki_A* 1hvb_A* 1pw1_A* 1pw8_A* 1mpl_A* 1pwd_A* 1pwc_A* 1scw_A* 1pwg_A* 3pte_A 1sde_A* Length = 349 Back     alignment and structure
>3o3v_A Beta-lactamase, CLBP protein; alpha/beta, disulfide bridge, hydrolase; 2.40A {Escherichia coli} Length = 335 Back     alignment and structure
>2qmi_A PBP related beta-lactamase; PAB87, octamer, LU-HPDO3A, archaea, hydrolase; HET: DO3; 2.20A {Pyrococcus abyssi} Length = 447 Back     alignment and structure
>1ei5_A D-aminopeptidase, DAP; penicillin binding protein, alpha/beta domain, beta barrel domain, hydrolase; 1.90A {Ochrobactrum anthropi} SCOP: b.61.3.1 b.61.3.1 e.3.1.1 Length = 520 Back     alignment and structure
>3tg9_A Penicillin-binding protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.20A {Bacillus halodurans} Length = 356 Back     alignment and structure
>3hlc_A Transesterase, LOVD; alpha/beta hydrolase fold, transferase; HET: PG4; 2.00A {Aspergillus terreus} PDB: 3hld_A* 3hlf_A* 3hle_A* 3hlg_A* 3hlb_A 3hl9_A Length = 432 Back     alignment and structure
>2dcf_A 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1.40A {Flavobacterium SP} SCOP: e.3.1.1 PDB: 3a65_A* 1wyc_A 2zm7_A* 2e8i_A* 2zma_A* 3a66_A* 2zm0_A* 1wyb_A 2zm8_A* 2zly_A* 2zm9_A* 2zm2_A* Length = 392 Back     alignment and structure
>4gb7_A 6-aminohexanoate-dimer hydrolase; structural genomics, IDP05595, national institute of allergy and infectious diseases; HET: MSE; 1.60A {Bacillus anthracis} Length = 422 Back     alignment and structure
>3i7j_A Beta-lactamase MB2281C; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 2.20A {Mycobacterium bovis} Length = 280 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query685
4gdn_A 342 Protein FLP; peptidase, alpha/beta, hydrolase; HET 100.0
1zkj_A 359 CMY-10, extended-spectrum beta-lactamase; plasmid, 100.0
2qz6_A 358 Beta-lactamase; psychrophIle, cold adaptation, ant 100.0
2drw_A 363 DAA, D-amino acid amidase; penicillin recognizing 100.0
2ffy_A 358 Beta-lactamase; AMPC, deacylation, transition stat 100.0
3rju_A 351 Beta-lactamase/D-alanine carboxypeptidase; structu 100.0
2wzx_A 371 Beta-lactamase; inhibitor, hydrolase, antibiotic r 100.0
1yqs_A 349 D-alanyl-D-alanine carboxypeptidase; cell well bio 100.0
1ci9_A 392 ESTB, protein (carboxylesterase); hydrolase, cabox 100.0
2qmi_A 447 PBP related beta-lactamase; PAB87, octamer, LU-HPD 100.0
3o3v_A 335 Beta-lactamase, CLBP protein; alpha/beta, disulfid 100.0
3tg9_A 356 Penicillin-binding protein; structural genomics, P 100.0
3zyt_A 372 Esterase A, ESTA; hydrolase, enzymatic promiscuity 100.0
1ei5_A 520 D-aminopeptidase, DAP; penicillin binding protein, 99.98
3hlc_A 432 Transesterase, LOVD; alpha/beta hydrolase fold, tr 99.98
2dcf_A 392 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1. 99.97
4gb7_A 422 6-aminohexanoate-dimer hydrolase; structural genom 99.96
3i7j_A 280 Beta-lactamase MB2281C; alpha-beta protein., struc 99.94
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.9
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.79
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.79
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.77
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.76
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.75
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.75
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.75
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.75
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.74
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.74
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.73
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.73
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.73
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.72
4aoj_A329 High affinity nerve growth factor receptor; transf 99.72
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.72
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.71
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.7
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.68
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.66
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.66
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.66
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.64
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.64
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 99.63
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.62
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.62
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.61
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.59
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.59
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.59
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.58
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.58
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.58
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.57
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.57
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.57
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.57
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.57
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.56
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.56
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.56
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.56
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.56
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.56
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.55
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.55
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.55
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.55
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.54
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.54
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.54
3ork_A311 Serine/threonine protein kinase; structural genomi 99.54
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.54
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.54
3niz_A311 Rhodanese family protein; structural genomics, str 99.54
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.53
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.53
3uqc_A286 Probable conserved transmembrane protein; structur 99.53
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.53
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.53
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.53
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.53
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.53
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.53
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.52
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.52
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.52
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.52
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.52
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.52
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.52
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.52
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.52
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.52
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.51
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.51
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.51
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.51
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.51
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.51
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.51
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.5
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.5
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.5
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.5
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.5
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.5
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.5
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.5
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.5
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.5
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.49
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.49
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.49
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.49
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.49
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.49
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.49
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.49
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.49
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.49
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.49
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.49
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.49
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.49
3q4u_A301 Activin receptor type-1; structural genomics conso 99.49
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.48
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.48
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.48
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.48
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.48
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.48
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.48
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.48
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.48
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.48
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.48
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.48
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.48
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.48
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.48
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.48
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.48
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.48
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.47
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.47
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.47
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.47
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.47
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.47
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.47
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.47
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.47
3soc_A322 Activin receptor type-2A; structural genomics cons 99.47
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.47
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.47
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.47
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.47
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.47
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.47
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.47
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.47
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.47
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.47
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.47
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.47
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.47
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.47
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.47
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.46
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.46
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.46
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.46
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.46
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.46
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.46
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.46
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.46
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.46
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.46
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.46
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.46
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.46
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.46
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.46
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.46
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.45
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.45
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.45
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.45
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.45
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.45
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.45
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.45
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.45
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.45
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.45
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.45
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.44
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.44
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.44
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.44
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.44
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.44
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.44
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.44
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.44
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.44
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.44
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.44
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.43
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.43
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.43
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.43
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.43
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.43
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.43
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.43
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.43
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.43
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.43
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.43
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.43
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.42
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.42
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.42
3bhy_A283 Death-associated protein kinase 3; death associate 99.42
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.42
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.42
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.41
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.41
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.41
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.41
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.41
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.41
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.41
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.41
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.41
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.41
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.41
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.41
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.41
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.4
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.4
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.4
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.39
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.39
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.39
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.39
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.39
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.39
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.39
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.38
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.38
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.38
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.38
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.37
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.37
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.37
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.35
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.35
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.34
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.34
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.33
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.33
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.32
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.32
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.3
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.3
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.29
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.29
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.28
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.23
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.22
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 99.15
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.07
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 98.93
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.81
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.79
3r70_A320 Aminoglycoside phosphotransferase; structural geno 98.77
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.73
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 98.71
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.65
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 98.57
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 98.5
2q83_A346 YTAA protein; 2635576, structural genomics, joint 98.44
3ats_A357 Putative uncharacterized protein; hypothetical pro 98.42
2cc1_A 262 Beta-lactamase, penicillinase; hydrolase, antibiot 98.3
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 98.3
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 98.22
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 98.17
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 98.11
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 98.05
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 98.05
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 98.04
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 98.04
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 98.0
1bsg_A 266 Beta lactamase, penicillinase; hydrolase, antibiot 97.79
1tvf_A 369 PBP4, penicillin binding protein 4; structural gen 97.76
1hzo_A 271 Beta-lactamase; mixed alpha/beta, cephalosporinase 97.73
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 97.64
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 97.63
3mes_A424 Choline kinase; malaria, structural genomics, stru 97.6
3a3j_A 344 PBP5; penicillin binding protein 5, DACA, hydrolas 97.52
2qpn_A287 Beta-lactamase GES-1; APO-enzyme, plasmid, hydrola 97.3
1xp4_A 379 D-alanyl-D-alanine carboxypeptidase; five-stranded 97.16
1o7e_A276 L2 beta lactamase; hydrolase, class A; 1.51A {Sten 97.1
2j9o_A298 TLL2115 protein; penicillin-binding protein, hydro 97.08
1m40_A263 TEM-1, beta-lactamase TEM; acylation mechanism, ul 96.99
1n9b_A265 Penicillinase, beta-lactamase SHV-2; beta-lactam h 96.95
1g6a_A271 Beta-lactamase PSE-4; class A beta-lactamase, carb 96.92
1bue_A265 Protein (imipenem-hydrolysing beta-lactamase); hyd 96.85
1es5_A262 DD-transpeptidase; penicillin-binding, serine pept 96.77
1e25_A282 Extended-spectrum beta-lactamase PER-1; hydrolase, 96.76
2p74_A263 Beta-lactamase CTX-M-9A; ultra-high resolution, ac 96.71
4hes_A275 Beta-lactamase class A-like protein; structural ge 96.62
2wk0_A 265 Beta-lactamase; hydrolase, iodopenicillanate, anti 96.62
3c5a_A264 Class A carbapenemase KPC-2; beta-lactamase, C-ter 96.45
4euz_A283 Carbapenem-hydrolizing beta-lactamase SFC-1; carba 96.03
3g15_A401 CK, chetk-alpha, choline kinase alpha; non-protein 96.01
3p09_A290 Beta-lactamase; structural genomics, center for st 95.84
4ewf_A275 Beta-lactamase; ABA-sandwich, structural genomics, 95.75
2wuq_A 318 BLAB, beta-lactamase regulatory protein BLAB; clas 95.71
3dw0_A294 Class A carbapenemase KPC-2; beta-lactamase, antib 95.71
3cjm_A282 Putative beta-lactamase; NP_815223.1, structural g 95.59
1w7f_A307 Beta-lactamase; hydrolase, isocitrate, bacillus li 95.07
4dxb_A637 RG13, maltose-binding periplasmic protein, beta-la 94.26
1cja_A342 Protein (actin-fragmin kinase); transferase; HET: 94.13
3ita_A 352 D-alanyl-D-alanine carboxypeptidase DACC; ppenicil 93.84
3qhy_A271 Beta-lactamase; enyzme-inhibitor complex, beta-pro 93.49
3hun_A 453 Penicillin-binding protein 4; ampicillin, beta-lac 93.49
3mzf_A 363 D-alanyl-D-alanine carboxypeptidase DACA; beta-lac 93.08
1ghp_A258 Beta-lactamase, penicillinase; hydrolase, antibiot 92.92
2xep_A 458 ORF12; hydrolase; 1.50A {Streptomyces clavuligerus 92.69
1alq_A266 CP254 beta-lactamase; hydrolase, circular permuted 92.3
3ny4_A265 Beta-lactamase, penicillinase; penicillin binding 89.99
3lez_A260 Beta-lactamase; antibiotic resistance, halotoleran 87.82
2bcf_A276 Probable D-alanyl-D-alanine carboxypeptidase DACB2 81.75
>4gdn_A Protein FLP; peptidase, alpha/beta, hydrolase; HET: PE4; 3.20A {Staphylococcus aureus} Back     alignment and structure
Probab=100.00  E-value=4.4e-38  Score=335.73  Aligned_cols=200  Identities=19%  Similarity=0.304  Sum_probs=174.0

Q ss_pred             hHHHHHHHHHHHhccCCCccceEEEEEECCeEEEEeeeecCCCCCCCCCCCCCccccccccHHHHHHHHHHHHHcCCCCC
Q 005658          477 DVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKL  556 (685)
Q Consensus       477 ~~~~~l~~~l~~~~~~~~~~g~~v~v~~~g~~v~~~~~G~~~~~~~~~~~~~t~f~i~S~sK~~ta~~i~~lve~G~l~l  556 (685)
                      +..+++++++++.++++.+||++++|+++|+++++.+||+++...+.|++++|+|+|||+||+|||+++++|+|+|+|+|
T Consensus        10 ~~~~~id~~i~~~~~~~~~pG~sv~V~~~g~~v~~~~~G~ad~~~~~~~~~~T~f~iaSvtK~~Ta~~i~~Lve~G~l~L   89 (342)
T 4gdn_A           10 DSQQQIDKIIEHDLQKGHIPGASILIVKNGKVFLNKGYGYQDVDKKVKASPTTKYEIASNTKAFTGLAILKLAQEGRLNL   89 (342)
T ss_dssp             CSSCSHHHHHHHHHHHHTCSEEEEEEEETTEEEEEEEEEEEETTTTEECCTTCEEECGGGGHHHHHHHHHHHHHHTSSCT
T ss_pred             HHHHHHHHHHHHHHHcCCCCEEEEEEEECCEEEEEEEEEEeccCCCCCCCCCCEEeeeeHHHHHHHHHHHHHHHcCCcch
Confidence            44567888888888889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCchhhhcCCCCcC---CCCCCCHHHHhcCcCCCCCCCCCccCCCCCCCCCHHHHHHHHhccCCCCCCCCccccccCcHH
Q 005658          557 EENIANIWPEFKSN---GKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFG  633 (685)
Q Consensus       557 ~d~v~~ylp~~~~~---~~~~iTi~~LL~htSGl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~~~Ys~~~~~  633 (685)
                      ||||++|+|++...   ..++|||+|||+||||++.+...... ........+++++.+...++.++||+.|.|||.+|.
T Consensus        90 dd~v~~ylP~~~~~~~~~~~~ITir~LL~HtSGl~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~PG~~~~Ysn~~y~  168 (342)
T 4gdn_A           90 NDDVSKHVPHFKMNYNGQNETITIKQLLAQTSGIPSDITSEDA-VTNKNNRLNDVTRAIMGDELHHKPGEEFEYSNMNYD  168 (342)
T ss_dssp             TSBGGGTSTTCCCEETTEECCCBHHHHHHTCSCCCCSCTTCSS-CCSSCCCSSCCHHHHHTSCCSSSTTSSCCCCHHHHH
T ss_pred             hheeeecCCccccccccCCCceEEeecccccCCCCCccccccc-cccccccHHHHHHHHhhCCCcCCCCceeeecCcccc
Confidence            99999999999643   35789999999999999875432211 111223456778888899999999999999999998


Q ss_pred             HHHHHHHHHHhCCCHHHHHHHhcccccCCCCcccCCCCCCCcccc
Q 005658          634 WLCGGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPGTNFLL  678 (685)
Q Consensus       634 ~llg~iie~vtg~~~~~~l~~~i~~PLgm~~t~~~~~~~~~~~~~  678 (685)
                       +||.|||++||++|++|++++||+||||++|.|...+......+
T Consensus       169 -lLg~iie~vtg~~~~~~~~~~i~~PLgm~~t~~~~~~~~~~~~a  212 (342)
T 4gdn_A          169 -LLGLIIQNVTKQSYTKYITNSWLKPLHMTHTSFKQTNNKSKHDA  212 (342)
T ss_dssp             -HHHHHHHHHHTSCHHHHHHHHTTTTTTCTTCEECCSCCCCSSBC
T ss_pred             -hHHHHHHHHHCcCHHHHHHHHHhcccCCCCcccCCCcccccccc
Confidence             99999999999999999999999999999998876655444333
>1zkj_A CMY-10, extended-spectrum beta-lactamase; plasmid, class C, hydrolase; 1.55A {Enterobacter aerogenes} Back     alignment and structure
>2qz6_A Beta-lactamase; psychrophIle, cold adaptation, antibiotic resistance, hydrolase, periplasm; 2.26A {Pseudomonas fluorescens} Back     alignment and structure
>2drw_A DAA, D-amino acid amidase; penicillin recognizing protein, D-stereospecific, hydrophobic, hydrolase; 2.10A {Ochrobactrum anthropi} SCOP: e.3.1.1 PDB: 2dns_A 2efu_A* 2efx_A* Back     alignment and structure
>2ffy_A Beta-lactamase; AMPC, deacylation, transition state, boronic acid, hydrolase; HET: SM3; 1.07A {Escherichia coli} SCOP: e.3.1.1 PDB: 1pi5_A* 1pi4_A* 2hds_A* 1c3b_A* 1fco_A* 1ga9_A* 1iem_A* 1kds_A* 1kdw_A* 1ke0_A* 1ke3_A* 1iel_A 1kvm_A* 1l2s_A* 1ll5_A* 1ll9_A* 1llb_A* 1mxo_A* 1my8_A* 1xgi_A* ... Back     alignment and structure
>3rju_A Beta-lactamase/D-alanine carboxypeptidase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich; HET: MSE CIT; 1.50A {Yersinia pestis} PDB: 3ozh_A* Back     alignment and structure
>2wzx_A Beta-lactamase; inhibitor, hydrolase, antibiotic resistance; HET: ZX0; 1.40A {Pseudomonas aeruginosa} PDB: 2wzz_A* 3s1y_A* 3s22_A* Back     alignment and structure
>1yqs_A D-alanyl-D-alanine carboxypeptidase; cell well biosynthesis, beta-lactam, beta-sultam, sulfonylation, hydrolase; HET: BSA; 1.05A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1cef_A* 1ceg_A* 1ikg_A* 1iki_A* 1hvb_A* 1pw1_A* 1pw8_A* 1mpl_A* 1pwd_A* 1pwc_A* 1scw_A* 1pwg_A* 3pte_A 1sde_A* Back     alignment and structure
>1ci9_A ESTB, protein (carboxylesterase); hydrolase, caboxylesterase; HET: DFP; 1.80A {Burkholderia gladioli} SCOP: e.3.1.1 PDB: 1ci8_A* Back     alignment and structure
>2qmi_A PBP related beta-lactamase; PAB87, octamer, LU-HPDO3A, archaea, hydrolase; HET: DO3; 2.20A {Pyrococcus abyssi} Back     alignment and structure
>3o3v_A Beta-lactamase, CLBP protein; alpha/beta, disulfide bridge, hydrolase; 2.40A {Escherichia coli} Back     alignment and structure
>3tg9_A Penicillin-binding protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.20A {Bacillus halodurans} Back     alignment and structure
>3zyt_A Esterase A, ESTA; hydrolase, enzymatic promiscuity, beta-lactamase; 2.45A {Arthrobacter nitroguajacolicus} Back     alignment and structure
>1ei5_A D-aminopeptidase, DAP; penicillin binding protein, alpha/beta domain, beta barrel domain, hydrolase; 1.90A {Ochrobactrum anthropi} SCOP: b.61.3.1 b.61.3.1 e.3.1.1 Back     alignment and structure
>3hlc_A Transesterase, LOVD; alpha/beta hydrolase fold, transferase; HET: PG4; 2.00A {Aspergillus terreus} PDB: 3hld_A* 3hlf_A* 3hle_A* 3hlg_A* 3hlb_A 3hl9_A Back     alignment and structure
>2dcf_A 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1.40A {Flavobacterium SP} SCOP: e.3.1.1 PDB: 3a65_A* 1wyc_A 2zm7_A* 2e8i_A* 2zma_A* 3a66_A* 2zm0_A* 1wyb_A 2zm8_A* 2zly_A* 2zm9_A* 2zm2_A* Back     alignment and structure
>4gb7_A 6-aminohexanoate-dimer hydrolase; structural genomics, IDP05595, national institute of allergy and infectious diseases; HET: MSE; 1.60A {Bacillus anthracis} Back     alignment and structure
>3i7j_A Beta-lactamase MB2281C; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 2.20A {Mycobacterium bovis} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2cc1_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, broad-spectrum; 2.13A {Mycobacterium fortuitum} SCOP: e.3.1.1 Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>1bsg_A Beta lactamase, penicillinase; hydrolase, antibiotic resistance; 1.85A {Streptomyces albus} SCOP: e.3.1.1 Back     alignment and structure
>1tvf_A PBP4, penicillin binding protein 4; structural genomics, nysgxrc target, SAV0642, PSI, protein structure initiative; 2.00A {Staphylococcus aureus} SCOP: b.105.1.2 e.3.1.1 Back     alignment and structure
>1hzo_A Beta-lactamase; mixed alpha/beta, cephalosporinase, hydrolase; HET: MES; 1.75A {Proteus vulgaris} SCOP: e.3.1.1 Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>3a3j_A PBP5; penicillin binding protein 5, DACA, hydrolase; 2.15A {Haemophilus influenzae} Back     alignment and structure
>2qpn_A Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1.10A {Klebsiella pneumoniae} PDB: 3nia_A* 3ni9_A* Back     alignment and structure
>1xp4_A D-alanyl-D-alanine carboxypeptidase; five-stranded antiparallel beta-sheet, omega-like loop, hydrolase; 2.80A {Streptococcus pneumoniae R6} SCOP: b.105.1.1 e.3.1.1 Back     alignment and structure
>1o7e_A L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrophomonas maltophilia} SCOP: e.3.1.1 PDB: 1n4o_A Back     alignment and structure
>2j9o_A TLL2115 protein; penicillin-binding protein, hydrolase, lactamase, thioestera DD-peptidase; 1.50A {Synechococcus elongatus} PDB: 2jbf_A* 2j7v_A 2j8y_A* Back     alignment and structure
>1m40_A TEM-1, beta-lactamase TEM; acylation mechanism, ultra- high resolution, hydrolase; HET: CB4; 0.85A {Escherichia coli} SCOP: e.3.1.1 PDB: 1jwp_A* 1nxy_A* 1ny0_A* 1nym_A* 1nyy_A* 1pzo_A* 1erm_A* 1ero_A* 1erq_A* 1s0w_A 1xpb_A 1li0_A 1htz_A 1jtd_A 1esu_A 1jwz_A* 1li9_A 1jwv_A* 1jtg_A 1axb_A* ... Back     alignment and structure
>1n9b_A Penicillinase, beta-lactamase SHV-2; beta-lactam hydrolase, detergent binding, drug design, radiation damage; HET: MA4 EPE; 0.90A {Klebsiella pneumoniae} SCOP: e.3.1.1 PDB: 3d4f_A* 2zd8_A* 1q2p_A* 1shv_A* 1vm1_A* 2g2u_A 2h5s_A* 1ong_A* 3c4o_A 3c4p_A 3mke_A* 3mkf_A* 3mxr_A* 3mxs_A* 3n4i_A 2a3u_A* 3opr_A* 3opl_A* 3oph_A* 3opp_A* ... Back     alignment and structure
>1g6a_A Beta-lactamase PSE-4; class A beta-lactamase, carbenicillinase, R234K mutant, hydrolase; 1.75A {Pseudomonas aeruginosa} SCOP: e.3.1.1 PDB: 1g68_A Back     alignment and structure
>1bue_A Protein (imipenem-hydrolysing beta-lactamase); hydrolase, antibiotic resistance, class A carbapenemase; 1.64A {Enterobacter cloacae} SCOP: e.3.1.1 PDB: 1bul_A* 1dy6_A Back     alignment and structure
>1es5_A DD-transpeptidase; penicillin-binding, serine peptidase, BET lactamase, hydrolase carboxypeptidase, hydrolase; 1.40A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1skf_A 1es2_A 1j9m_A 1esi_A 1es3_A 1es4_A Back     alignment and structure
>1e25_A Extended-spectrum beta-lactamase PER-1; hydrolase, antibiotic resistance, class A cephalosporinase; 1.9A {Pseudomonas aeruginosa} SCOP: e.3.1.1 Back     alignment and structure
>2p74_A Beta-lactamase CTX-M-9A; ultra-high resolution, acylation, ESBL, hydrolase; HET: PO4; 0.88A {Escherichia coli} PDB: 3g2y_A* 4dds_A* 4ddy_A* 4de0_A* 4de1_A* 4de2_A* 4de3_A* 1ylj_A* 1yly_A* 1ym1_A* 1yms_A* 1ymx_A* 3g2z_A* 3g30_A* 3g31_A* 3g32_A* 3g34_A* 3g35_A* 1ylt_A* 1ylz_A* ... Back     alignment and structure
>4hes_A Beta-lactamase class A-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, COG COG2367, H; HET: MSE; 1.90A {Veillonella parvula} Back     alignment and structure
>2wk0_A Beta-lactamase; hydrolase, iodopenicillanate, antibiotic resistance; HET: BIY CIT; 1.65A {Bacillus licheniformis} PDB: 2x71_A* 3b3x_A* 1i2s_A* 1i2w_A* 2y91_A* 2blm_A 4blm_A 3sh9_A* 3sh7_A* 3sh8_A* 3ly3_A 3kgo_A* 3ly4_A* 3kgm_A* 3kgn_A* 3m2j_A* 3m2k_A* 3soi_A* 1mbl_A Back     alignment and structure
>3c5a_A Class A carbapenemase KPC-2; beta-lactamase, C-terminal deleted mutant, plasmid, hydrolase; HET: CIT; 1.23A {Escherichia coli} PDB: 3rxw_A* 3rxx_A* 2ods_A 2ov5_A* 3e2k_A 3e2l_A* Back     alignment and structure
>4euz_A Carbapenem-hydrolizing beta-lactamase SFC-1; carbapenemase, hydrolase, antibiotic resistance, beta-lactam complex; HET: HAR MEM; 1.08A {Serratia fonticola} PDB: 4eqi_A 4ev4_A* Back     alignment and structure
>3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* Back     alignment and structure
>3p09_A Beta-lactamase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich, cytosol; HET: MSE; 1.90A {Francisella tularensis subsp} Back     alignment and structure
>4ewf_A Beta-lactamase; ABA-sandwich, structural genomics, midwest center for struct genomics (MCSG), PSI-biology, cytoplasmic, hydrolase; 2.00A {Sphaerobacter thermophilus} Back     alignment and structure
>2wuq_A BLAB, beta-lactamase regulatory protein BLAB; class A beta-lactamase fold, transcription regulation, beta-lactamase induction, transcription; 1.80A {Streptomyces cacaoi} Back     alignment and structure
>3dw0_A Class A carbapenemase KPC-2; beta-lactamase, antibiotic resistance, hydrolase; 1.60A {Escherichia coli} Back     alignment and structure
>3cjm_A Putative beta-lactamase; NP_815223.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: MSE; 1.50A {Enterococcus faecalis} Back     alignment and structure
>1w7f_A Beta-lactamase; hydrolase, isocitrate, bacillus licheniformis hydrolase; HET: ICT; 1.80A {Bacillus licheniformis} Back     alignment and structure
>4dxb_A RG13, maltose-binding periplasmic protein, beta-lactama chimera; TEM, beta-lactamase, MBP, allosteric regulation, zinc bindin maltose binding; 2.29A {Escherichia coli} PDB: 4dxc_A Back     alignment and structure
>1cja_A Protein (actin-fragmin kinase); transferase; HET: AMP; 2.90A {Physarum polycephalum} SCOP: d.144.1.3 Back     alignment and structure
>3ita_A D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-binding protein, BP6, DD-carboxypeptidase, peptidoglycan, ampicillin, acyl-enzyme complex; HET: AIX AIC; 1.80A {Escherichia coli} PDB: 3it9_A* 3itb_A* Back     alignment and structure
>3qhy_A Beta-lactamase; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Bacillus anthracis} Back     alignment and structure
>3hun_A Penicillin-binding protein 4; ampicillin, beta-lactamase, serine type D-Ala, D-Ala-carboxypeptidase, antibiotics; HET: ZZ7; 2.00A {Staphylococcus aureus} PDB: 3hum_A* Back     alignment and structure
>3mzf_A D-alanyl-D-alanine carboxypeptidase DACA; beta-lactam antibiotic, penicillin-binding protein, DD- carboxypeptidase, hydrolase; HET: IM2; 1.50A {Escherichia coli} PDB: 1nzu_A 1nzo_A* 3beb_A* 3bec_A* 3mzd_A* 3mze_A* 1z6f_A* 1nj4_A 1hd8_A 1sdn_A 4drt_A Back     alignment and structure
>1ghp_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, beta-lactam hydrolysis, benzylpenicillin, cephaloridine; HET: PNM; 1.76A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1ghi_A* 1ghm_A* 1kgf_A 1kge_A 1ome_A 1kgg_A 1dja_A 3blm_A 1blh_A* 1blc_A 1djc_A 1djb_A 1blp_A 1pio_A Back     alignment and structure
>2xep_A ORF12; hydrolase; 1.50A {Streptomyces clavuligerus} PDB: 2xf3_A* 2xfs_A* 2xft_A 2xgn_A 2xh9_A* Back     alignment and structure
>1alq_A CP254 beta-lactamase; hydrolase, circular permuted, antibiotic resistance; 1.80A {Staphylococcus aureus} SCOP: e.3.1.1 Back     alignment and structure
>3ny4_A Beta-lactamase, penicillinase; penicillin binding protein, beta-lactam complex, hydrolase-A complex; HET: SMX; 1.22A {Mycobacterium tuberculosis} PDB: 3m6b_A* 3dwz_A* 3iqa_A* 3cg5_A* 3m6h_A* 4df6_A* 2gdn_A 3vfh_A* 3vff_A* 3n8l_A* 3n6i_A* 3n7w_A* 3n8r_A* 3n8s_A* 3nbl_A* 3nc8_A* 3nck_A* 3nde_A* 3ndg_A* Back     alignment and structure
>3lez_A Beta-lactamase; antibiotic resistance, halotolerant, DEEP- SEA bacterium, hydrolase; HET: EPE; 1.25A {Oceanobacillus iheyensis} SCOP: e.3.1.1 Back     alignment and structure
>2bcf_A Probable D-alanyl-D-alanine carboxypeptidase DACB2; penicillin-binding protein, DD-2 carboxypeptidase, directed evolution; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 685
d1ci9a_ 377 e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli 2e-20
d2drwa1 362 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochro 7e-19
d1onha_ 363 e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterob 2e-17
d1ei5a3 333 e.3.1.1 (A:3-335) D-aminopeptidase, N-terminal dom 4e-17
d2hdsa1 358 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Es 1e-16
d1yqsa1 345 e.3.1.1 (A:3-347) D-ala carboxypeptidase/transpept 4e-15
>d1ci9a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]} Length = 377 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: beta-lactamase/transpeptidase-like
superfamily: beta-lactamase/transpeptidase-like
family: beta-Lactamase/D-ala carboxypeptidase
domain: Esterase EstB
species: Burkholderia gladioli [TaxId: 28095]

 Score = 91.7 bits (226), Expect = 2e-20
 Identities = 47/179 (26%), Positives = 81/179 (45%), Gaps = 16/179 (8%)

Query: 476 SDVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFS 535
           + + A+L     +   + +++G      + GE++   + G+  R   RP++ D+LF + S
Sbjct: 2   ASLAARLDAVFDQALRERRLVGAVAIVARHGEILYRRAQGLADREAGRPMREDTLFRLAS 61

Query: 536 VTKGITAGMLHWLVDNGKLKLEENIANIWPEFKSNGK----DLIKVHHVLNHTSGLHNVS 591
           VTK I A  +  LV  G+L L+  +    PEF+         L+ +HH+L HTSGL    
Sbjct: 62  VTKPIVALAVLRLVARGELALDAPVTRWLPEFRPRLADGSEPLVTIHHLLTHTSGLGYWL 121

Query: 592 VD----------LSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLCGGII 640
           ++          +S    L   D DE L R+A +     PG    + Y     + G ++
Sbjct: 122 LEGAGSVYDRLGISDGIDLRDFDLDENLRRLASAPLSFAPGSG--WQYSLALDVLGAVV 178
>d2drwa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} Length = 362 Back     information, alignment and structure
>d1onha_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]} Length = 363 Back     information, alignment and structure
>d1ei5a3 e.3.1.1 (A:3-335) D-aminopeptidase, N-terminal domain {Ochrobactrum anthropi [TaxId: 529]} Length = 333 Back     information, alignment and structure
>d2hdsa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} Length = 358 Back     information, alignment and structure
>d1yqsa1 e.3.1.1 (A:3-347) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]} Length = 345 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query685
d1onha_ 363 AMPC beta-Lactamase, class C {Enterobacter cloacae 100.0
d2hdsa1 358 AMPC beta-Lactamase, class C {Escherichia coli, ce 100.0
d2drwa1 362 D-Amino acid amidase DaaA {Ochrobactrum anthropi [ 100.0
d1ci9a_ 377 Esterase EstB {Burkholderia gladioli [TaxId: 28095 100.0
d1yqsa1 345 D-ala carboxypeptidase/transpeptidase {Streptomyce 100.0
d1ei5a3 333 D-aminopeptidase, N-terminal domain {Ochrobactrum 100.0
d2dcfa1 388 6-aminohexanoate-dimer hydrolase NylC {Flavobacter 99.95
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.81
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.74
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.73
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.73
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.72
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.72
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.72
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.72
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.72
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.71
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.71
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.71
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.71
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.7
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.7
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.7
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.7
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.69
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.69
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.69
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.68
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.68
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.68
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.66
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.66
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.66
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.65
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.65
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.65
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.64
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.64
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.64
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.64
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.63
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.63
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.63
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.62
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.61
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.61
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.6
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.6
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.59
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.59
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.59
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.59
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.59
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.56
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.56
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.56
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.56
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.55
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.55
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.55
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.54
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.53
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.51
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.51
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.46
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.45
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.24
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.8
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 98.53
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.39
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.3
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 97.66
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.54
d1tvfa2301 Pencillin binding protein 4 (PbpD), N-terminal dom 96.75
d1e25a_278 beta-Lactamase, class A {Pseudomonas aeruginosa, P 96.4
d1m40a_263 beta-Lactamase, class A {Escherichia coli, TEM-1 [ 95.62
d1n9ba_265 beta-Lactamase, class A {Klebsiella pneumoniae, SH 95.53
d1o7ea_267 beta-Lactamase, class A {Stenotrophomonas maltophi 95.45
d1iysa_261 beta-Lactamase, class A {Escherichia coli, TOHO-1 95.45
d1es5a_260 D-ala carboxypeptidase/transpeptidase {Streptomyce 95.43
d1g6aa_266 beta-Lactamase, class A {Pseudomonas aeruginosa, P 95.3
d1buea_265 beta-Lactamase, class A {Enterobacter cloacae, NMC 95.1
d1xp4a2269 D,D-carboxypeptidase DacA, N-terminal domain {Stre 95.02
d3beca2259 Penicillin-binding protein 5, N-terminal domain {E 94.76
d2cc1a1262 beta-Lactamase, class A {Mycobacterium fortuitum [ 94.29
d1bsga_266 beta-Lactamase, class A {Streptomyces albus G [Tax 92.3
d1djaa_258 beta-Lactamase, class A {Staphylococcus aureus [Ta 85.96
d1i2sa_255 beta-Lactamase, class A {Bacillus licheniformis [T 84.22
d1pyya4 368 Penicillin-binding protein 2x (pbp-2x), transpepti 84.15
>d1onha_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: beta-lactamase/transpeptidase-like
superfamily: beta-lactamase/transpeptidase-like
family: beta-Lactamase/D-ala carboxypeptidase
domain: AMPC beta-Lactamase, class C
species: Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]

Probab=100.00  E-value=2e-36  Score=323.22  Aligned_cols=189  Identities=20%  Similarity=0.325  Sum_probs=173.0

Q ss_pred             hHHHHHHHHHHHhccCCCccceEEEEEECCeEEEEeeeecCCCCCCCCCCCCCccccccccHHHHHHHHHHHHHcCCCCC
Q 005658          477 DVEAKLRDFLVELGNDGKILGIQVCAYKDGEVIIDTSAGMLGRYDPRPVQPDSLFPVFSVTKGITAGMLHWLVDNGKLKL  556 (685)
Q Consensus       477 ~~~~~l~~~l~~~~~~~~~~g~~v~v~~~g~~v~~~~~G~~~~~~~~~~~~~t~f~i~S~sK~~ta~~i~~lve~G~l~l  556 (685)
                      ++.+.+++.+++.++++.+||++|+|+++|++++. .||+++...+.|++++|+|+|||+||+|||+++++|+|+|+|+|
T Consensus         6 ~l~~~v~~~i~~~~~~~~~pG~~v~V~~~g~~~~~-~~G~~~~~~~~p~~~dT~f~iaSitK~~ta~~i~~L~e~G~l~l   84 (363)
T d1onha_           6 QLAEVVANTVTPLMKAQSVPGMAVAVIYQGKPHYY-TFGKADIAANKPVTPQTLFELGSISKTFTGVLGGDAIARGEISL   84 (363)
T ss_dssp             HHHHHHHHHHHHHHHHTTCSEEEEEEEETTEEEEE-EEEEEETTTTEECCTTCBEECGGGHHHHHHHHHHHHHHHTSCCT
T ss_pred             HHHHHHHHHHHHHHHhCCCCeEEEEEEECCEEEEE-eEEecccCCCCCCCCCCEEEeeehHHHHHHHHHHHHHhcCccee
Confidence            66777999999999999999999999999999984 78999999999999999999999999999999999999999999


Q ss_pred             CCchhhhcCCCCcCCCCCCCHHHHhcCcCCCCCCCCCccCCCCCCCCCHHHHHHHHhccCCCCCCCCccccccCcHHHHH
Q 005658          557 EENIANIWPEFKSNGKDLIKVHHVLNHTSGLHNVSVDLSSENPLLICDWDECLNRIALSAPETEPGQEQLYHYLSFGWLC  636 (685)
Q Consensus       557 ~d~v~~ylp~~~~~~~~~iTi~~LL~htSGl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pg~~~~Ys~~~~~~ll  636 (685)
                      ||||++|+|++..+++++|||+|||+||||+.....      +....+.+++++.+...++.++||+.|.|||.+|. +|
T Consensus        85 ddpv~~ylp~~~~~~~~~ITi~~LL~HtSGl~~~~~------~~~~~~~~~~~~~~~~~~~~~~PG~~~~Ysn~~~~-ll  157 (363)
T d1onha_          85 DDPVTRYWPQLTGKQWQGIRMLDLATYTAGGLPLQV------PDEVTDNASLLRFYQNWQPQWKPGTTRLYANASIG-LF  157 (363)
T ss_dssp             TSBGGGTCTTCCCGGGTTCBHHHHHHTCSSCCCSSC------CTTCCSHHHHHHHHHHCCCSSCTTSEECCCHHHHH-HH
T ss_pred             eeccchhhhhcccccccccchhhHhhccccCccccC------ccccCCHHHHHHHHHHhhhhcCCceeeecccccee-hh
Confidence            999999999999888889999999999999754432      23346788999999999999999999999999998 99


Q ss_pred             HHHHHHHhCCCHHHHHHHhcccccCCCCcccCCCCCC
Q 005658          637 GGIIERASGKKFQEILEEGIIQPLSIDGELYIGIPPG  673 (685)
Q Consensus       637 g~iie~vtg~~~~~~l~~~i~~PLgm~~t~~~~~~~~  673 (685)
                      |.|||+++|++|++|++++||+||||++|++...+..
T Consensus       158 g~iie~~tg~~~~~~~~e~i~~PLgm~~t~~~~~~~~  194 (363)
T d1onha_         158 GALAVKPSGMPYEQAMTTRVLKPLKLDHTWINVPKAE  194 (363)
T ss_dssp             HHHHTGGGTSCHHHHHHHHTTTTTTCTTEESSCCGGG
T ss_pred             hhhhhhhcCCChhhhhHHHHHhhcCcccccccCCccc
Confidence            9999999999999999999999999999977654443
>d2hdsa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} Back     information, alignment and structure
>d2drwa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1ci9a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]} Back     information, alignment and structure
>d1yqsa1 e.3.1.1 (A:3-347) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]} Back     information, alignment and structure
>d1ei5a3 e.3.1.1 (A:3-335) D-aminopeptidase, N-terminal domain {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d2dcfa1 e.3.1.1 (A:5-392) 6-aminohexanoate-dimer hydrolase NylC {Flavobacterium sp. [TaxId: 239]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1tvfa2 e.3.1.1 (A:15-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1e25a_ e.3.1.1 (A:) beta-Lactamase, class A {Pseudomonas aeruginosa, PER-1 [TaxId: 287]} Back     information, alignment and structure
>d1m40a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]} Back     information, alignment and structure
>d1n9ba_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-2 [TaxId: 573]} Back     information, alignment and structure
>d1o7ea_ e.3.1.1 (A:) beta-Lactamase, class A {Stenotrophomonas maltophilia, L2 [TaxId: 40324]} Back     information, alignment and structure
>d1iysa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]} Back     information, alignment and structure
>d1es5a_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15 [TaxId: 1931]} Back     information, alignment and structure
>d1g6aa_ e.3.1.1 (A:) beta-Lactamase, class A {Pseudomonas aeruginosa, PSE-4 carbenicillinase [TaxId: 287]} Back     information, alignment and structure
>d1buea_ e.3.1.1 (A:) beta-Lactamase, class A {Enterobacter cloacae, NMC-A carbapenemase [TaxId: 550]} Back     information, alignment and structure
>d1xp4a2 e.3.1.1 (A:25-293) D,D-carboxypeptidase DacA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3beca2 e.3.1.1 (A:4-262) Penicillin-binding protein 5, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cc1a1 e.3.1.1 (A:27-293) beta-Lactamase, class A {Mycobacterium fortuitum [TaxId: 1766]} Back     information, alignment and structure
>d1bsga_ e.3.1.1 (A:) beta-Lactamase, class A {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
>d1djaa_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1i2sa_ e.3.1.1 (A:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1pyya4 e.3.1.1 (A:264-631) Penicillin-binding protein 2x (pbp-2x), transpeptidase domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure