BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 005664
(684 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2LD1|A Chain A, Structures And Chemical Shift Assignments For The Add
Domain Of The Atrx Protein
pdb|2LBM|A Chain A, Solution Structure Of The Add Domain Of Atrx Complexed
With Histone Tail H3 1-15 K9me3
Length = 142
Score = 30.4 bits (67), Expect = 3.4, Method: Composition-based stats.
Identities = 19/67 (28%), Positives = 27/67 (40%), Gaps = 22/67 (32%)
Query: 122 AAAEQQGNGDDALF-CTLCNAEVRRFSKH------------CRSCDKCV---------DG 159
A A+++G+G + CT C +V F K C++C K DG
Sbjct: 2 AMADKRGDGLHGIVSCTACGQQVNHFQKDSIYRHPSLQVLICKNCFKYYMSDDISRDSDG 61
Query: 160 FDHHCRW 166
D CRW
Sbjct: 62 MDEQCRW 68
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.134 0.408
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,769,383
Number of Sequences: 62578
Number of extensions: 633791
Number of successful extensions: 926
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 926
Number of HSP's gapped (non-prelim): 1
length of query: 684
length of database: 14,973,337
effective HSP length: 105
effective length of query: 579
effective length of database: 8,402,647
effective search space: 4865132613
effective search space used: 4865132613
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)