Citrus Sinensis ID: 005700

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680--

MENPNWSMVELEAPSEEDFLRAEHHTAAPANKTRNRNAKQLTWVLLLKAHKAAGCLTSIASAFFSLGSLVRRRVAAGRTDQPPTSADTHEIQKLRTRFFYSCIKLFLWLSVVLFAFELCAYFKGWHFATPNLQLQYIFQSPLAIKGAFDLLYSSWVLVRVHYLAPPLQFLANACIVLFLIQSLDRLILCLGCFWIRFKRIKPVPKHDDTSDLESGQKGFFPMVLVQIPMCNEKEVYQQSIAAVCNLDWPKSKILIQVLDDSDDPTAQTLIKEEVLKWQEAGANIVYRHRILRDGYKAGNLKSAMNCSYVKDYEFVAIFDADFQPNPDFLRRTVPHFKDNEELGLVQARWSFVNKDENLLTRLQDINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLRGWKFIFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRAKISMGKKFNLIFLFFLLRKLILPFYSFTLFCIILPMTMFIPEAELPAWVVCYIPATMSFLNILPAPKSFPFIVPYLLFENTMSVTKFNAMISGLFQLGSAYEWVVTKKSGRSSEGDLVSLVEKESKHNKGSSVPNLSEVKMETKQEKMVSKKKKKKKHNRIYMKELTLAFLLLTASARSLLSAQGIHFYFLLFQGVSFLLVGLDLIGEQLD

cccccEEEEEEccccccHHHHHccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEcccccccccccHHHHHccccccccCEEEEEccccccccHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHccccEEEEEEccccccEEEccccHHHHHHHHHHHcccccccccccHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccccccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHHHHHEEccccccccc

***PNWSMVELEAPSEED********************KQLTWVLLLKAHKAAGCLTSIASAFFSLGSLVRRRVAAG****************LRTRFFYSCIKLFLWLSVVLFAFELCAYFKGWHFATPNLQLQYIFQSPLAIKGAFDLLYSSWVLVRVHYLAPPLQFLANACIVLFLIQSLDRLILCLGCFWIRFKRIKPV*********ESGQKGFFPMVLVQIPMCNEKEVYQQSIAAVCNLDWPKSKILIQVLDDSDDPTAQTLIKEEVLKWQEAGANIVYRHRILRDGYKAGNLKSAMNCSYVKDYEFVAIFDADFQPNPDFLRRTVPHFKDNEELGLVQARWSFVNKDENLLTRLQDINLSFHFEVEQQVNGVFINFFGFNGTAGVWRIKALEDSGGWMERTTVEDMDIAVRAHLRGWKFIFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCLPDIIRAKISMGKKFNLIFLFFLLRKLILPFYSFTLFCIILPMTMFIPEAELPAWVVCYIPATMSFLNILPAPKSFPFIVPYLLFENTMSVTKFNAMISGLFQLGSAYEWVVTKKSGRSSEGDLVSLVEKE*********PNLSEVKM***********KKKKKHNRIYMKELTLAFLLLTASARSLLSAQGIHFYFLLFQGVSFLLVGLDLIGEQL*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable xyloglucan glycosyltransferase 12	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose.	confident	Q9ZQB9
Putative xyloglucan glycosyltransferase 10	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose.	confident	Q84Z01
Probable xyloglucan glycosyltransferase 7	Probable beta-1,4-glucan synthase rather involved in the synthesis of the xyloglucan backbone than cellulose. Seems to work simultaneously with xyloglucan 6-xylosyltransferase. Xyloglucan is a noncellulosic polysaccharides of plant cell wall and consists of a glucan backbone substituted by xylose, galactose and fucose.	confident	Q6L538

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4HG6, chain A
Confidence level:very confident
Coverage over the Query: 143-583
View the alignment between query and template
View the model in PyMOL