BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 005732
(680 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4G24|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From
A. Thaliana With Mn
pdb|4G26|A Chain A, Crystal Structure Of Proteinaceous Rnase P 1 (Prorp1) From
A. Thaliana With Ca
Length = 501
Score = 35.0 bits (79), Expect = 0.13, Method: Compositional matrix adjust.
Identities = 19/70 (27%), Positives = 30/70 (42%)
Query: 486 LFEIMLEQDIVPNAATFVGVLSACVRAGLVNEGMKIFRSMKSYGVVPTLEHYTCVVDLLG 545
+F+ M+ +VPN ATF V + + MK++G+ P L Y +
Sbjct: 92 IFKQMIVDKVVPNEATFTNGARLAVAKDDPEMAFDMVKQMKAFGIQPRLRSYGPALFGFC 151
Query: 546 RSGHLHEAEE 555
R G +A E
Sbjct: 152 RKGDADKAYE 161
>pdb|3L46|A Chain A, Crystal Structure Of The Second Brct Domain Of Epithelial
Cell Transforming 2 (Ect2)
pdb|3L46|B Chain B, Crystal Structure Of The Second Brct Domain Of Epithelial
Cell Transforming 2 (Ect2)
Length = 112
Score = 33.1 bits (74), Expect = 0.57, Method: Composition-based stats.
Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)
Query: 546 RSGHLHEAEEFIKDMPIELDAVVWGALLSACWFWMNMEVGERAAQKMFGLDK 597
R HL E +KD+P E ++ ++ WFW ++++ RA + M+ +K
Sbjct: 58 RCTHLVVEENIVKDLPFEPSKKLY--VVKQEWFWGSIQMDARAGETMYLYEK 107
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.135 0.410
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,205,152
Number of Sequences: 62578
Number of extensions: 763053
Number of successful extensions: 1653
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1652
Number of HSP's gapped (non-prelim): 3
length of query: 680
length of database: 14,973,337
effective HSP length: 105
effective length of query: 575
effective length of database: 8,402,647
effective search space: 4831522025
effective search space used: 4831522025
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)