Citrus Sinensis ID: 005738


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680
MDTIGFFPFPILCSLIVFLTCFTFSQISFQEFKNKLLEPGLVDRIVVTNKSVAKVFVKSTPRSTNETNDDFTQSPVNGSPDKRNLSQCKYYFNIGSVESFEEKLEEAQEALGIDPHDYIPVTYENEVNWYQELMRFAPTALLFGALWFMGRKMQSGLGVGGPGGRGGRGIFNIGKATITKMDMNAKDKVFFKDVAGCDEAKQEIMEFVHFLKNPKKYEELGAKIPKGALLVGPPGTGKTLLAKATAGESGVPFLSMSGSDFMEMFVGVGPSRVRSLFQEARQCAPSIVFIDEIDAIGRARGRGGFSGGNDERESTLNQLLVEMDGFGTTAGVVVLAGTNRPDILDKALLRPGRFDRQITIDKPDIKGRDQIFQIYLKKLKLDNEPSFYSQRLAALTPGFAGADIANVCNEAALIAARNESAQITMQHFEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMTKPYSSKTGAIIDNEVREWVGKAYDHTVKLIEEHREHVAQIAEELLEKEVLHQDDLVRVLGERPFKHSEPTNYDRFKKGFLEDDKESKETKEGGTAEDDNSSSPLEPEVVPT
ccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccEEEEEcccEEEEEEEccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEccccEEEccccccccEEEccccccHHHHHHHHHHHHHccccHHHHHHccccccccEEEccccccHHHHHHHHHccccccEEEEccccEEEEccccccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccHHHHHHccccccccEEEEEECccccccccccccccccccccHHHHHHHHHHHHccHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccHHHHcccccccccccccccccccccccccccccccccccc
MDTIGFFPFPILCSLIVFLTCFTFSQISFQEFKNKLLEPGLVDRIVVTNKSVAKVFVKSTP***********************LSQCKYYFNIGSVESFEEKLEEAQEALGIDPHDYIPVTYENEVNWYQELMRFAPTALLFGALWFMGRKMQSGLGVG*******RGIFNIGKATITKMDMNAKDKVFFKDVAGCDEAKQEIMEFVHFLKNPKKYEELGAKIPKGALLVGPPGTGKTLLAKATAGESGVPFLSMSGSDFMEMFVGVGPSRVRSLFQEARQCAPSIVFIDEIDAIGRARG*************TLNQLLVEMDGFGTTAGVVVLAGTNRPDILDKALLRPGRFDRQITIDKPDIKGRDQIFQIYLKKLKLDNEPSFYSQRLAALTPGFAGADIANVCNEAALIAARNESAQITMQHFEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMTKPYSSKTGAIIDNEVREWVGKAYDHTVKLIEEHREHVAQIAEELLEKEVLHQDDLVRVLGERP************************************************
xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTIGFFPFPILCSLIVFLTCFTFSQISFQEFKNKLLEPGLVDRIVVTNKSVAKVFVKSTPRSTNETNDDFTQSPVNGSPDKRNLSQCKYYFNIGSVESFEEKLEEAQEALGIDPHDYIPVTYENEVNWYQELMRFAPTALLFGALWFMGRKMQSGLGVGGPGGRGGRGIFNIGKATITKMDMNAKDKVFFKDVAGCDEAKQEIMEFVHFLKNPKKYEELGAKIPKGALLVGPPGTGKTLLAKATAGESGVPFLSMSGSDFMEMFVGVGPSRVRSLFQEARQCAPSIVFIDEIDAIGRARGRGGFSGGNDERESTLNQLLVEMDGFGTTAGVVVLAGTNRPDILDKALLRPGRFDRQITIDKPDIKGRDQIFQIYLKKLKLDNEPSFYSQRLAALTPGFAGADIANVCNEAALIAARNESAQITMQHFEAAIDRVIGGLEKKNKVISKLERRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCMTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMTKPYSSKTGAIIDNEVREWVGKAYDHTVKLIEEHREHVAQIAEELLEKEVLHQDDLVRVLGERPFKHSEPTNYDRFKKGFLEDDKESKETKEGGTAEDDNSSSPLEPEVVPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent zinc metalloprotease FTSH 10, mitochondrial Probable ATP-dependent zinc metallopeptidase. Involved in the assembly and/or stability of the complexes I and V of the mitochondrial oxidative phosphorylation system.confidentQ8VZI8
ATP-dependent zinc metalloprotease FTSH 8, mitochondrial Probable ATP-dependent zinc metallopeptidase.probableQ0DHL4
ATP-dependent zinc metalloprotease FtsH Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins.probableQ3B6R3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R62, chain A
Confidence level:very confident
Coverage over the Query: 186-298,309-438
View the alignment between query and template
View the model in PyMOL
Template: 2DHR, chain A
Confidence level:very confident
Coverage over the Query: 177-633
View the alignment between query and template
View the model in PyMOL
Template: 2LNA, chain A
Confidence level:very confident
Coverage over the Query: 24-63,85-128
View the alignment between query and template
View the model in PyMOL