BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 005743
         (679 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2VF7|A Chain A, Crystal Structure Of Uvra2 From Deinococcus Radiodurans
 pdb|2VF7|B Chain B, Crystal Structure Of Uvra2 From Deinococcus Radiodurans
 pdb|2VF7|C Chain C, Crystal Structure Of Uvra2 From Deinococcus Radiodurans
 pdb|2VF8|A Chain A, Crystal Structure Of Uvra2 From Deinococcus Radiodurans
 pdb|2VF8|B Chain B, Crystal Structure Of Uvra2 From Deinococcus Radiodurans
          Length = 842

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 9/58 (15%)

Query: 599 QNIEDVVAFVKWLDDELGFLVDERAVLKHFDWPEKKADTLREAAFGYRDLKKLESEVS 656
           +NI DV+A    +D+   F  DE A+ +  D       TLRE   GY  L +  +E+S
Sbjct: 684 KNIADVLALT--VDEAHDFFADESAIFRALD-------TLREVGLGYLRLGQPATELS 732


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.125    0.345 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,449,132
Number of Sequences: 62578
Number of extensions: 590105
Number of successful extensions: 1167
Number of sequences better than 100.0: 26
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 24
Number of HSP's that attempted gapping in prelim test: 1157
Number of HSP's gapped (non-prelim): 29
length of query: 679
length of database: 14,973,337
effective HSP length: 105
effective length of query: 574
effective length of database: 8,402,647
effective search space: 4823119378
effective search space used: 4823119378
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 55 (25.8 bits)