Citrus Sinensis ID: 005745


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------68
MAAKRESGSGGGSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLPSDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVRSDNSILFYFLNQVLNGVL
ccccccccccccccEEEccccccccHHHHHHHHHccccccccccccCEEEEEEcccccccccccEEEccccccccccccccHHHcccccccCEEEEEEEEEcccHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccEEEEEEEECccccccccEECccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccccccEEEcccccHHccccccCEEEEEEccccccccccHHHHHHHHHHHHcccccEEEEEEEEEcccccccccEEEEEEEECcccccccccccccEEEEECccccccccEEcccccccHHHHHHHHHHHHHHHHHHHccccccHHHHccccEEEEcccccHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccCEEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHccccEEEEECccCEEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccCEEEECccccccccccHHHHHHHHHHHHHHHHHHcccc
***************QFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLP****************RNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEA***********GLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPK********************LGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVRSDNSILFYFLNQVLNGVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKRESGSGGGSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLPSDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVRSDNSILFYFLNQVLNGVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-like modifier-activating enzyme atg7 E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 and ATG8 for its conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes. Involved in the senescence process.probableQ94CD5
Ubiquitin-like modifier-activating enzyme ATG7 Probable E1-like activating enzyme involved in cytoplasm to vacuole transport (Cvt) and autophagy.probableP0CM38
Ubiquitin-like modifier-activating enzyme ATG7 Probable E1-like activating enzyme involved in cytoplasm to vacuole transport (Cvt) and autophagy.probableQ6FQY7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VX8, chain D
Confidence level:very confident
Coverage over the Query: 13-73,88-332
View the alignment between query and template
View the model in PyMOL
Template: 3RUI, chain A
Confidence level:very confident
Coverage over the Query: 333-522,549-608,622-678
View the alignment between query and template
View the model in PyMOL