Citrus Sinensis ID: 005751

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------68

MQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTSGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQYVWESKADGAFAISEDTWNEPLGRGTEIRLHLRDEAGEYLEESKLKELVKKYSEFINFPIYIWASKEVDVDVPTDEDDSSDEEEKAEKEEETEKSESESEDEDEDSEKKPKTKTVKETTFEWELLNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLYESYYNTNKANLKLYVRRVFISDEFDELLPKYLNFLKGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKIAEEDPDESTGKDKKDVEKFSDDDDKKGQYTKFWNEFGKSIKLGIIEDAANRNRLAKLLRFESTKSDGKLTSLDQYISRMKAGQKDIFYITGANKEQLEKSPFLERLKKKNYEVIFFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKLGKDTKDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISPDAAVEEEDDVEETDADTEMKESSAAKEDVDTEYSGKDEL

cEEEEcccccEEEEEEccccccHHHHHHcHHHHHcccHHHHHHHHccccccccccccccccccEEEEccEEEEEEcccccccEEEEEcccccEEEEEcccccccccccEEEEEEcccHHccccHHHHHHHHHHHcccccccEEEEEEEEECcccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHHHHHHHcccccccccccEEEEEEEcCEEEEEEEEECccccccccccccccccccccEEEEEEEEEEccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHcHHHHHHHHcccccccccccccHHHHHHHcccccccEEEEEcccHHHHHccHHHHHHHHcccEEEEccccHHHHHHHcccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccEEEEEccccccHHHHHHHHHcccccccHHHccccccEEEEccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc

MQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTSGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQYVWESKADGAFAISEDTWNEPLGRGTEIRLHLRDEAGEYLEESKLKELVKKYSEFINFPIYIWASKEVD*********************************************VKETTFEWELLNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLYESYYNTNKANLKLYVRRVFISDEFDELLPKYLNFLKGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKIAE********************DDKKGQYTKFWNEFGKSIKLGIIEDAANRNRLAKLLRFESTKSDGKLTSLDQYISRMKAGQKDIFYITGANKEQLEKSPFLERLKKKNYEVIFFTDPVDEYLMQYLMDYEDKKFQNVSK*****************FKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERI******************RVLEINPRHPIIKELRERVV****DAGVQQTAQLIYQTALMESGFSLNDPKDFASRIYSTVKSSLN******************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQIKLDKEKKILSIRDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTSGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQYVWESKADGAFAISEDTWNEPLGRGTEIRLHLRDEAGEYLEESKLKELVKKYSEFINFPIYIWASKEVDVDVPTDEDDSxxxxxxxxxxxxxxxxxxxxxxxxxxSEKKPKTKTVKETTFEWELLNDVKAIWLRNPKEVTEEEYAKFYHSLVKDFSDEKPLAWSHFNAEGDVEFKAVLFVPPKAPHDLYESYYNTNKANLKLYVRRVFISDEFDELLPKYLNFLKGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKIAEEDPDESTGKDKKDVEKFSDDDDKKGQYTKFWNEFGKSIKLGIIEDAANRNRLAKLLRFESTKSDGKLTSLDQYISRMKAGQKDIFYITGANKEQLEKSPFLERLKKKNYEVIFFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKLGKDTKDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDAGVQQTAQLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISPDAAVEEEDDVEETDADTEMKESSAAKEDVDTEYSGKDEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Endoplasmin homolog	May have a molecular chaperone role in the processing of secreted materials.	probable	P35016
Endoplasmin homolog	May have a molecular chaperone role in the processing of secreted materials. Required for shoot apical meristem (SAM), root apical meristem (RAM) and floral meristem (FM) formation, probably by regulating the folding of CLAVATA proteins (CLVs). Also involved in pollen tube elongation.	probable	Q9STX5
Heat shock protein 90	Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.	probable	P24724

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PEH, chain A
Confidence level:very confident
Coverage over the Query: 1-208
View the alignment between query and template
View the model in PyMOL

Template: 2CG9, chain A
Confidence level:very confident
Coverage over the Query: 207-268,280-351,374-558,572-637
View the alignment between query and template
View the model in PyMOL