BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 005768
         (678 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2X6F|A Chain A, The Crystal Structure Of The Drosophila Class Iii
           Pi3-Kinase Vps34 In Complex With 3-Methyladenine
 pdb|2X6F|B Chain B, The Crystal Structure Of The Drosophila Class Iii
           Pi3-Kinase Vps34 In Complex With 3-Methyladenine
 pdb|2X6H|A Chain A, The Crystal Structure Of The Drosophila Class Iii
           Pi3-Kinase Vps34
 pdb|2X6H|B Chain B, The Crystal Structure Of The Drosophila Class Iii
           Pi3-Kinase Vps34
 pdb|2X6I|A Chain A, The Crystal Structure Of The Drosophila Class Iii
           Pi3-kinase Vps34 In Complex With Pik-90
 pdb|2X6I|B Chain B, The Crystal Structure Of The Drosophila Class Iii
           Pi3-kinase Vps34 In Complex With Pik-90
 pdb|2X6J|A Chain A, The Crystal Structure Of The Drosophila Class Iii
           Pi3-Kinase Vps34 In Complex With Pik-93
 pdb|2X6J|B Chain B, The Crystal Structure Of The Drosophila Class Iii
           Pi3-Kinase Vps34 In Complex With Pik-93
 pdb|2X6K|A Chain A, The Crystal Structure Of The Drosophila Class Iii
           Pi3-Kinase Vps34 In Complex With Pi-103
 pdb|2X6K|B Chain B, The Crystal Structure Of The Drosophila Class Iii
           Pi3-Kinase Vps34 In Complex With Pi-103
          Length = 696

 Score = 32.3 bits (72), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 51/119 (42%), Gaps = 15/119 (12%)

Query: 199 DLRHLVLELKNQSDFS---VKNLKMKVSHPRFLSIGNRDDMTKEFPACLQKMTNAEQSVA 255
           +LR +   L+ Q  F    VK +K+    P     GNR+  T++F   L     AEQ + 
Sbjct: 340 NLRGIFYNLRKQRRFIDELVKLVKLVAKEP-----GNRNKKTEKFQKLL-----AEQDMF 389

Query: 256 GGNFNKMPQAVFSFPEGISIQGETPLLWPLWYRAAVPGKISLSITIYYEMGDVSSVIKY 314
             NF       F     I I    P+   L+  A +P K++   +I +   + +++ K+
Sbjct: 390 KVNFTNFEPIPFPLDPEIYITKIVPMRTSLFKSALMPAKLTFVTSIAHH--EYAAIFKH 446


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.131    0.382 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,751,783
Number of Sequences: 62578
Number of extensions: 727147
Number of successful extensions: 1555
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1555
Number of HSP's gapped (non-prelim): 1
length of query: 678
length of database: 14,973,337
effective HSP length: 105
effective length of query: 573
effective length of database: 8,402,647
effective search space: 4814716731
effective search space used: 4814716731
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 55 (25.8 bits)