Citrus Sinensis ID: 005837


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-----
MLGRVEQVMLAKAAASFGLPLASPPLRRNSNTDKLMNKCVLPLLNPNPVGRPGARVVLVRASGGDGGGGGYSRTPLETAGACELIDNDTGEKVIVWGGTDDDHDHDPPIPPKHLLDSSNWNKDPSQPTTSAPVLRNNDCSIPSKKGVISSFSRLKAQRVKAVVDKRSAMGKKTVNALKQEGRLSKTTPSLENFRELGEHIVDNDVPAESIDKNISDYNSRSNKHEKSGTKIDRGWRSGGSIHNLQYEPTDCPKQRHKYSADGDFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQGLSKSTSGSPRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRCAILDEVDILFNDEDFEVALQSLISSSPVTAQYLFVTATLPVEIYNKLVEVFPDCKVVMGPGMHRISPGLEEFLVDCSGDQESDKTPETAFLNKKSALLQLIEKSPVSKTIVFCNKIVTCRKVENILKRFDRKETRVRVLPFHAALDQETRLANMKEFTTSRSKEARLFLVCTDRASRGIDFAGVDHVVLFDFPRDPSEYVRRVGRTARGAGGTGKAFIFVVGKQVSLAQRIMERNRKGHPLHDVPSAFELMR
cccHHHHHHHHHHHHHccccccccccccccccHHHHccccccccccccccccccEEEEEEEccccccccccccccccccccCEEEccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHccccHHccccEEEEccccccHHHHcHHHHHHHHHHHHHHccccccccccEEEEEcccHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHccccEEEccccHHHHccccccEEcccccEEEEEcccccccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHcccccEEEEcccccccccEEEEEEEcccccccccccHHHcccHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccccccccccEEEEccccccccccccccccccccccccccEEEEEcHHHHHHHHHHHHHHccccccccccccccccc
*******VMLAKAAASFGLPLASPP*R***NTDKLMNKCVLPLLNPNPVGRPGARVVL****************PLETAGACELIDNDTGEKVIVWGGTDDDH***********************************CSIPSK**********************************************************************************************************************DFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLR***************RVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRCAILDEVDILFNDEDFEVALQSLISSSPVTAQYLFVTATLPVEIYNKLVEVFPDCKVVMGPGMHRISPGLEEFLVDCSGDQESDKTPETAFLNKKSALLQLIEKSPVSKTIVFCNKIVTCRKVENILKRFDRKETRVRVLPFHAALDQETRLANMKEFTTSRSKEARLFLVCTDRASRGIDFAGVDHVVLFDFPRDPSEYVRRVGRTARGAGGTGKAFIFVVGKQVSLAQRIMERNRKGHPLHDVPS*F**M*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLGRVEQVMLAKAAASFGLPLASPPLRRNSNTDKLMNKCVLPLLNPNPVGRPGARVVLVRASGGDGGGGGYSRTPLETAGACELIDNDTGEKVIVWGGTDDDHDHDPPIPPKHLLDSSNWNKDPSQPTTSAPVLRNNDCSIPSKKGVISSFSRLKAQRVKAVVDKRSAMGKKTVNALKQEGRLSKTTPSLENFRELGEHIVDNDVPAESIDKNISDYNSRSNKHEKSGTKIDRGWRSGGSIHNLQYEPTDCPKQRHKYSADGDFFSRKSFKELGCSDYMIESLKRQNFLRPSQIQAMAFPPVVEGKSCILADQSGSGKTLAYLLPVIQRLRQEELQGLSKSTSGSPRVVILAPTAELASQVLSNCRSLSKCGVPFRSMVVTGGFRQKTQLENLQEGVDVLIATPGRFMFLIKEGILQLINLRCAILDEVDILFNDEDFEVALQSLISSSPVTAQYLFVTATLPVEIYNKLVEVFPDCKVVMGPGMHRISPGLEEFLVDCSGDQESDKTPETAFLNKKSALLQLIEKSPVSKTIVFCNKIVTCRKVENILKRFDRKETRVRVLPFHAALDQETRLANMKEFTTSRSKEARLFLVCTDRASRGIDFAGVDHVVLFDFPRDPSEYVRRVGRTARGAGGTGKAFIFVVGKQVSLAQRIMERNRKGHPLHDVPSAFELMR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DEAD-box ATP-dependent RNA helicase 50 Probably involved in resistance to biotic and abiotic stresses. Confers tolerance to oxidative stress and mediates pathogenesis-related (PR) genes expression. Exhibits RNA-dependent ATPase and ATP-dependent RNA helicase activities in vitro.probableQ0DVX2
DEAD-box ATP-dependent RNA helicase 50 Probably involved in resistance to biotic and abiotic stresses.probableQ8GUG7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.4.-Acting on acid anhydrides; involved in cellular and subcellular movement.probable
3.6.4.13RNA helicase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I4I, chain A
Confidence level:very confident
Coverage over the Query: 268-502,515-674
View the alignment between query and template
View the model in PyMOL
Template: 3H1T, chain A
Confidence level:confident
Coverage over the Query: 291-353,364-382,393-430,442-643
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
4f92, chain B confident Alignment | Template Structure