Citrus Sinensis ID: 005842

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670----

MWESESESLGGRDYGNGVLSSTKLSVKTDGFELRGQSWYVATDIPSDFLVQIGDVNFHLHKYPLLSRSGKMNRLIYESRDSELNKIVLDDLPGGPEAFELAAKFCYGIAVDLTASNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSIIVLKSCEKLSPWAENLQIVRRCSESIAWKACANPKGIRWAYTGRPPKISSPKWNDMKDSSPSRSQPVPPDWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYAAKWLTGLIRESSGTADEISSYSASNSNGSCSSWKGGLHMIVAGMKDDPPTVQAKDQRMIIESLISIIPPQKDSVSCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAYSKGETLYDVDLVQRLLEHFLVQEQTESSSPSRQSFSDKHMYDASQRGNGTSAKMRVARLVDGYLTEVARDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERLPLRIVVQVLFSEQIKISNAMANSTLKEAGESQYQPMISNRKSLLEATPQSFQEGWATAKKDINTLKFELESVKAKYLELQNDMETLQRQFDKLTKQKQTSAWTSGWKKLGKLTKMTATDHQDIRPQVPNAAEQTRKTPRRWRNSIS

ccccccccccccccccccccccccccccccccccccCEEEEccccccEEEEEccEEEEEcccccccccHHHHHHHcccccccccEEEcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccHHHHHccccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc

**********************K*SVKTDGFELRGQSWYVATDIPSDFLVQIGDVNFHLHKYPLLSRSGKMNRLIYESRDSELNKIVLDDLPGGPEAFELAAKFCYGIAVDLTASNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSIIVLKSCEKLSPWAENLQIVRRCSESIAWKACANPKGIRWAY****************************DWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYAAKWLTGLIR********************CSSWKG*******************DQRMIIESLISIIPPQKDSVSCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAYSKGETLYDVDLVQRLLEHFLV*********************************RVARLVDGYLTEVARDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERLPLRIVVQVLFSEQ****************************************GWATAKKDINTLKFELESVKAKYLELQN*********************TS******************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MWESESESLGGRDYGNGVLSSTKLSVKTDGFELRGQSWYVATDIPSDFLVQIGDVNFHLHKYPLLSRSGKMNRLIYESRDSELNKIVLDDLPGGPEAFELAAKFCYGIAVDLTASNISGLRCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSIIVLKSCEKLSPWAENLQIVRRCSESIAWKACANPKGIRWAYTGRPPKISSPKWNDMKDSSPSRSQPVPPDWWFEDVSILRIDHFVRVVTAIKVKGMRFELIGAAIMHYAAKWLTGLIRESSGTADEISSYSASNSNGSCSSWKGGLHMIVAGMKDDPPTVQAKDQRMIIESLISIIPPQKDSVSCSFLLRLLRMANMLKVAPALVTELEKRVGMQFEQATLADLLIPAYSKGETLYDVDLVQRLLEHFLVQEQTESSSPSRQSFSDKHMYDASQRGNGTSAKMRVARLVDGYLTEVARDRNLSLTKFQVLAEALPESARTCDDGLYRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSIDACMHAAQNERLPLRIVVQVLFSEQIKISNAMANSTLKEAGESQYQPMISNRKSLLEATPQSFQEGWATAKKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKQTSAWTSGWKKLGKLTKMTATDHQDIRPQVPNAAEQTRKTPRRWRNSIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Root phototropism protein 3	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Signal transducer of the phototropic response and photo-induced movements. Involved in the phot1 pathway under low blue light (LBL) fluence rate and in the phot2 pathway under higher fluence rate of blue light (HBL). Necessary for root and hypocotyl phototropisms, but not for the regulation of stomata opening. Not involved in chloroplast accumulation and translocation.	confident	Q9FMF5
Coleoptile phototropism protein 1	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Plays a role as signal transduction component in coleoptile phototropism and lateral translocation of auxin.	probable	Q5KS50

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z8H, chain A
Confidence level:very confident
Coverage over the Query: 33-153
View the alignment between query and template
View the model in PyMOL

Template: 3I3N, chain A
Confidence level:confident
Coverage over the Query: 34-195,229-272,322-370
View the alignment between query and template
View the model in PyMOL

Template: 2YY0, chain A
Confidence level:probable
Coverage over the Query: 588-620
View the alignment between query and template
View the model in PyMOL